KEGG   Homo sapiens (human): 2689Help
Entry
2689              CDS       T01001                                 

Gene name
GH2, GH-V, GHL, GHV, hGH-V
Definition
growth hormone 2
Orthology
K05438  
growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    2689 (GH2)
   04151 PI3K-Akt signaling pathway
    2689 (GH2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2689 (GH2)
   04060 Cytokine-cytokine receptor interaction
    2689 (GH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24.2
AA seq 217 aa AA seqDB search
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttggcctgctctgcctgtcctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccgtcgcctgtaccagctggcatatgacacctatcaggagtttgaagaagcc
tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccaacaccttccaacagggtgaaaacgcagcagaaatctaacctagag
ctgctccgcatctccctgctgctcatccagtcatggctggagcccgtgcagctcctcagg
agcgtcttcgccaacagcctggtgtatggcgcctcggacagcaacgtctatcgccacctg
aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccgg
actgggcagatcttcaatcagtcctacagcaagtttgacacaaaatcgcacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

DBGET integrated database retrieval system