KEGG   Homo sapiens (human): 269Help
Entry
269               CDS       T01001                                 

Gene name
AMHR2, AMHR, MISR2, MISRII, MRII
Definition
(RefSeq) anti-Mullerian hormone receptor type 2
  KO
K04672  anti-mullerian hormone receptor type-2 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
Module
hsa_M00679  BMP signaling
Disease
H00609  46,XY disorders of sex development (Other)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    269 (AMHR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    269 (AMHR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     269 (AMHR2)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   269 (AMHR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Sensor APH
Motif
Other DBs
NCBI-GeneID: 269
NCBI-ProteinID: NP_065434
OMIM: 600956
HGNC: 465
Ensembl: ENSG00000135409
Vega: OTTHUMG00000170048
Pharos: Q16671(Tbio)
UniProt: Q16671
Position
12q13.13
AA seq 573 aa AA seqDB search
MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRC
CFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANY
SHLPPPGSPGTPGSQGPQAAPGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGE
PVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKLVAIKAFPPRSVAQF
QAERALYELPGLQHDHIVRFITASRGGPGRLLSGPLLVLELHPKGSLCHYLTQYTSDWGS
SLRMALSLAQGLAFLHEERWQNGQYKPGIAHRDLSSQNVLIREDGSCAIGDLGLALVLPG
LTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWEI
LSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFATDPDGL
RELLEDCWDADPEARLTAECVQQRLAALAHPQESHPFPESCPRGCPPLCPEDCTSIPAPT
ILPCRPQRSACHFSVQQGPCSRNPQPACTLSPV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgctagggtctttggggctttgggcattacttcccacagctgtggaagcacccccaaac
aggcgaacctgtgtgttctttgaggcccctggagtgcggggaagcacaaagacactggga
gagctgctagatacaggcacagagctccccagagctatccgctgcctctacagccgctgc
tgctttgggatctggaacctgacccaagaccgggcacaggtggaaatgcaaggatgccga
gacagtgatgagccaggctgtgagtccctccactgtgacccaagtccccgagcccacccc
agccctggctccactctcttcacctgctcctgtggcactgacttctgcaatgccaattac
agccatctgcctcctccagggagccctgggactcctggctcccagggtccccaggctgcc
ccaggtgagtccatctggatggcactggtgctgctggggctgttcctcctcctcctgctg
ctgctgggcagcatcatcttggccctgctacagcgaaagaactacagagtgcgaggtgag
ccagtgccagagccaaggccagactcaggcagggactggagtgtggagctgcaggagctg
cctgagctgtgtttctcccaggtaatccgggaaggaggtcatgcagtggtttgggccggg
cagctgcaaggaaaactggttgccatcaaggccttcccaccgaggtctgtggctcagttc
caagctgagagagcattgtacgaacttccaggcctacagcacgaccacattgtccgattt
atcactgccagccgggggggtcctggccgcctgctctctgggcccctgctggtactggaa
ctgcatcccaagggctccctgtgccactacttgacccagtacaccagtgactggggaagt
tccctgcggatggcactgtccctggcccagggcctggcatttctccatgaggagcgctgg
cagaatggccaatataaaccaggtattgcccaccgagatctgagcagccagaatgtgctc
attcgggaagatggatcgtgtgccattggagacctgggccttgccttggtgctccctggc
ctcactcagccccctgcctggacccctactcaaccacaaggcccagctgccatcatggaa
gctggcacccagaggtacatggcaccagagctcttggacaagactctggacctacaggat
tggggcatggccctccgacgagctgatatttactctttggctctgctcctgtgggagata
ctgagccgctgcccagatttgaggcctgacagcagtccaccacccttccaactggcctat
gaggcagaactgggcaatacccctacctctgatgagctatgggccttggcagtgcaggag
aggaggcgtccctacatcccatccacctggcgctgctttgccacagaccctgatgggctg
agggagctcctagaagactgttgggatgcagacccagaagcacggctgacagctgagtgt
gtacagcagcgcctggctgccttggcccatcctcaagagagccacccctttccagagagc
tgtccacgtggctgcccacctctctgcccagaagactgtacttcaattcctgcccctacc
atcctcccctgtaggcctcagcggagtgcctgccacttcagcgttcagcaaggcccttgt
tccaggaatcctcagcctgcctgtaccctttctcctgtgtaa

DBGET integrated database retrieval system