KEGG   Homo sapiens (human): 2690Help
Entry
2690              CDS       T01001                                 

Gene name
GHR, GHBP
Definition
growth hormone receptor
Orthology
K05080  
growth hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Disease
H00254  
Pituitary Dwarfism (PD)
Drug target
Somatropin: 
Somatrem: 
Pegvisomant: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    2690 (GHR)
   04151 PI3K-Akt signaling pathway
    2690 (GHR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2690 (GHR)
   04060 Cytokine-cytokine receptor interaction
    2690 (GHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13-p12
AA seq 638 aa AA seqDB search
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEES
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHIKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttttct
ggaagtgaggccacagcagctatccttagcagagcaccctggagtctgcaaagtgttaat
ccaggcctaaagacaaattcttctaaggagcctaaattcaccaagtgccgttcacctgag
cgagagactttttcatgccactggacagatgaggttcatcatggtacaaagaacctagga
cccatacagctgttctataccagaaggaacactcaagaatggactcaagaatggaaagaa
tgccctgattatgtttctgctggggaaaacagctgttactttaattcatcgtttacctcc
atctggataccttattgtatcaagctaactagcaatggtggtacagtggatgaaaagtgt
ttctctgttgatgaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacgtcagtttaactgggattcatgcagatatccaagtgagatgggaagcaccacgcaat
gcagatattcagaaaggatggatggttctggagtatgaacttcaatacaaagaagtaaat
gaaactaaatggaaaatgatggaccctatattgacaacatcagttccagtgtactcattg
aaagtggataaggaatatgaagtgcgtgtgagatccaaacaacgaaactctggaaattat
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgagccaatttacatgtgaa
gaagatttctactttccatggctcttaattattatctttggaatatttgggctaacagtg
atgctatttgtattcttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaatcgatccagatctcctcaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgatagctataaacccgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgatgagccagatgaaaagactgaggaatca
gacacagacagacttctaagcagtgaccatgagaaatcacatagtaacctaggggtgaag
gatggcgactctggacgtaccagctgttgtgaacctgacattctggagactgatttcaat
gccaatgacatacatgagggtacctcagaggttgctcagccacagaggttaaaaggggaa
gcagatctcttatgccttgaccagaagaatcaaaataactcaccttatcatgatgcttgc
cctgctactcagcagcccagtgttatccaagcagagaaaaacaaaccacaaccacttcct
actgaaggagctgagtcaactcaccaagctgcccatattcagctaagcaatccaagttca
ctgtcaaacatcgacttttatgcccaggtgagcgacattacaccagcaggtagtgtggtc
ctttccccgggccaaaagaataaggcagggatgtcccaatgtgacatgcacccggaaatg
gtctcactctgccaagaaaacttccttatggacaatgcctacttctgtgaggcagatgcc
aaaaagtgcatccctgtggctcctcacatcaaggttgaatcacacatacagccaagctta
aaccaagaggacatttacatcaccacagaaagccttaccactgctgctgggaggcctggg
acaggagaacatgttccaggttctgagatgcctgtcccagactatacctccattcatata
gtacagtccccacagggcctcatactcaatgcgactgccttgcccttgcctgacaaagag
tttctctcatcatgtggctatgtgagcacagaccaactgaacaaaatcatgccttag

DBGET integrated database retrieval system