KEGG   Homo sapiens (human): 2694Help
Entry
2694              CDS       T01001                                 

Gene name
GIF, IF, IFMH, INF, TCN3
Definition
gastric intrinsic factor (vitamin B synthesis)
Orthology
K14615  
gastric intrinsic factor
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H01277  
Vitamin B12 deficiency anaemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    2694 (GIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 417 aa AA seqDB search
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIA
MNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENW
APSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLAL
TCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPS
KKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPS
NPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFE
TTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcctggtttgccctctacctcctgagccttctctgggctacagctgggactagtacc
cagacccagagttcatgctccgttccctcagcacaggagcccttggtcaatggaatacaa
gtactcatggagaactcggtgacttcatcagcctacccaaaccccagcatcctgattgcc
atgaatctggccggagcctacaacttgaaggcccagaagctcctgacttaccagctcatg
tccagcgacaacaacgatctaaccattgggcagctcggcctcaccatcatggccctcacc
tcctcctgccgagaccctggggataaagtatccattctacaaagacaaatggagaactgg
gcaccttccagccccaacgctgaagcatcagccttctatgggcccagtctagcgatcttg
gcactgtgccagaagaactctgaggcgaccttgccgatagccgtccgctttgccaagacc
ctgctggccaactcctctcccttcaatgtagacacaggagcaatggcaaccttggctctg
acctgtatgtacaacaagatccctgtaggttcagaggaaggttacagatccctgtttggt
caggtactaaaggatattgtggagaaaatcagcatgaagatcaaagataatggcatcatt
ggagacatctacagtactggcctcgccatgcaggctctctctgtaacacctgagccatct
aaaaaggaatggaactgcaagaagactacggatatgatactcaatgagattaagcagggg
aaattccacaaccccatgtccattgctcaaatcctcccttccctgaaaggcaagacatac
ctagatgtgccccaggtcacttgtagtcctgatcatgaggtacaaccaactctacccagc
aaccctggccctggccccacctctgcatctaacatcactgtcatatacaccataaataac
cagctgaggggggttgagctgctcttcaacgagaccatcaatgttagtgtgaaaagtggg
tcagtgttacttgttgtcctagaggaagcacagcgcaaaaatcctatgttcaaatttgaa
accacaatgacatcttggggccttgtcgtctcttctatcaacaatatcgcggaaaatgtt
aatcacaagacatactggcagtttcttagtggtgtaacacctttgaatgaaggggttgct
gactacatacccttcaaccacgagcacatcacagccaatttcacacagtactaa

DBGET integrated database retrieval system