KEGG   Homo sapiens (human): 2696Help
Entry
2696              CDS       T01001                                 

Gene name
GIPR, PGQTL2
Definition
(RefSeq) gastric inhibitory polypeptide receptor
  KO
K04580  
gastric inhibitory polypeptide receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2696 (GIPR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2696 (GIPR)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Gut peptide
   Gastric inhibitory peptide
    2696 (GIPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 466 aa AA seqDB search
MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLA
CNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCEN
PEKNEAFLDQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSF
MLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVY
LHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIR
TPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPV
TEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctccgatcctgcagctgctgctgcggctctcactgtgcgggctgctgctc
cagagggcggagacaggctctaaggggcagacggcgggggagctgtaccagcgctgggaa
cggtaccgcagggagtgccaggagaccttggcagccgcggaaccgccttcaggcctcgcc
tgtaacgggtccttcgatatgtacgtctgctgggactatgctgcacccaatgccactgcc
cgtgcgtcctgcccctggtacctgccctggcaccaccatgtggctgcaggtttcgtcctc
cgccagtgtggcagtgatggccaatggggactttggagagaccatacacaatgtgagaac
ccagagaagaatgaggcctttctggaccaaaggctcatcttggagcggttgcaggtcatg
tacactgtcggctactccctgtctctcgccacactgctgctagccctgctcatcttgagt
ttgttcaggcggctacattgcactagaaactatatccacatcaacctgttcacgtctttc
atgctgcgagctgcggccattctcagccgagaccgtctgctacctcgacctggcccctac
cttggggaccaggcccttgcgctgtggaaccaggccctcgctgcctgccgcacggcccag
atcgtgacccagtactgcgtgggtgccaactacacgtggctgctggtggagggcgtctac
ctgcacagtctcctggtgctcgtgggaggctccgaggagggccacttccgctactacctg
ctcctcggctggggggcccccgcgcttttcgtcattccctgggtgatcgtcaggtacctg
tacgagaacacgcagtgctgggagcgcaacgaagtcaaggccatttggtggattatacgg
acccccatcctcatgaccatcttgattaatttcctcatttttatccgcattcttggcatt
ctcctgtccaagctgaggacacggcaaatgcgctgccgggattaccggctgaggctggct
cgctccacgctgacgctggtgcccctgctgggtgtccacgaggtggtgtttgctcccgtg
acagaggaacaggcccggggcgccctgcgcttcgccaagctcggctttgagatcttcctc
agctccttccagggcttcctggtcagcgtcctctactgcttcatcaacaaggaggtgcag
tcggagatccgccgtggctggcaccactgccgcctgcgccgcagcctgggcgaggagcaa
cgccagctcccggagcgcgccttccgggccctgccctccggctccggcccgggcgaggtc
cccaccagccgcggcttgtcctcggggaccctcccagggcctgggaatgaggccagccgg
gagttggaaagttactgctag

DBGET integrated database retrieval system