KEGG   Homo sapiens (human): 26996Help
Entry
26996             CDS       T01001                                 

Gene name
GPR160, GPCR1, GPCR150
Definition
(RefSeq) G protein-coupled receptor 160
  KO
K08438  
G protein-coupled receptor 160
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    26996 (GPR160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.2-q27
AA seq 338 aa AA seqDB search
MTALSSENCSFQYQLRQTNQPLDVNYLLFLIILGKILLNILTLGMRRKNTCQNFMEYFCI
SLAFVDLLLLVNISIILYFRDFVLLSIRFTKYHICLFTQIISFTYGFLHYPVFLTACIDY
CLNFSKTTKLSFKCQKLFYFFTVILIWISVLAYVLGDPAIYQSLKAQNAYSRHCPFYVSI
QSYWLSFFMVMILFVAFITCWEEVTTLVQAIRITSYMNETILYFPFSSHSSYTVRSKKIF
LSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEMNIPWLYFVNSFLIATVYWFNCHKLN
LKDIGLPLDPFVNWKCCFIPLTIPNLEQIEKPISIMIC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgactgctctctcttcagagaactgctcttttcagtaccagttacgtcaaacaaaccag
cccctagatgttaactatctgctattcttgatcatacttgggaaaatattattaaatatc
cttacactaggaatgagaagaaaaaacacctgtcaaaattttatggaatatttttgcatt
tcactagcattcgttgatcttttacttttggtaaacatttccattatattgtatttcagg
gattttgtacttttaagcattaggttcactaaataccacatctgcctatttactcaaatt
atttcctttacttatggctttttgcattatccagttttcctgacagcttgtatagattat
tgcctgaatttctctaaaacaaccaagctttcatttaagtgtcaaaaattattttatttc
tttacagtaattttaatttggatttcagtccttgcttatgttttgggagacccagccatc
taccaaagcctgaaggcacagaatgcttattctcgtcactgtcctttctatgtcagcatt
cagagttactggctgtcatttttcatggtgatgattttatttgtagctttcataacctgt
tgggaagaagttactactttggtacaggctatcaggataacttcctatatgaatgaaact
atcttatattttcctttttcatcccactccagttatactgtgagatctaaaaaaatattc
ttatccaagctcattgtctgttttctcagtacctggttaccatttgtactacttcaggta
atcattgttttacttaaagttcagattccagcatatattgagatgaatattccctggtta
tactttgtcaatagttttctcattgctacagtgtattggtttaattgtcacaagcttaat
ttaaaagacattggattacctttggatccatttgtcaactggaagtgctgcttcattcca
cttacaattcctaatcttgagcaaattgaaaagcctatatcaataatgatttgttaa

DBGET integrated database retrieval system