KEGG   Homo sapiens (human): 26999Help
Entry
26999             CDS       T01001                                 

Gene name
CYFIP2, PIR121
Definition
cytoplasmic FMR1 interacting protein 2
Orthology
K05749  
cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    26999 (CYFIP2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    26999 (CYFIP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q33.3
AA seq 1253 aa AA seqDB search
MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLAD
IVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMVQIRDDHIRFI
SELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIY
AALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKG
GFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFF
FTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMM
EYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSV
LLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLD
QAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITL
HVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHI
YSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICR
LPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCD
LLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLL
TKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIP
VGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPL
KKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcacgtcaccctggaagatgccctgtccaacgtggacctgcttgaagagctt
cccctccccgaccagcagccatgcatcgagcctccaccttcctccatcatgtaccaggct
aactttgacacaaactttgaggacaggaatgcatttgtcacgggcattgcaaggtacatt
gagcaggctacagtccactccagcatgaatgagatgctggaggaaggacatgagtatgcg
gtcatgctgtacacctggcgcagctgttcccgggccattccccaggtgaaatgcaacgag
cagcccaaccgagtagagatctatgagaagacagtagaggtgctggagccggaggtcacc
aagctcatgaagttcatgtattttcagcgcaaggccatcgagcggttctgcagcgaggtg
aagcggctgtgccatgccgagcgcaggaaggactttgtctctgaggcctacctcctgacc
cttggcaagttcatcaacatgtttgctgtcctggatgagctaaagaacatgaagtgcagc
gtcaagaatgaccactctgcctacaagagggcagcacagttcctgcggaagatggcagat
ccccagtctatccaggagtcgcagaacctttccatgttcctggccaaccacaacaggatc
acccagtgtctccaccagcaacttgaagtgatcccaggctatgaggagctgctggctgac
attgtcaacatctgtgtggattactacgagaacaagatgtacctgactcccagtgagaaa
catatgctcctcaaggtgatgggctttggcctctacctaatggatggaaatgtcagtaac
atttacaaactggatgccaagaagagaattaatcttagcaaaattgataaattctttaag
cagctgcaggtggtgccccttttcggcgacatgcagatagagctggccagatacattaag
accagtgctcactatgaagagaacaagtccaagtggacgtgcacccagagcagcatcagc
ccccagtacaatatctgcgagcagatggttcagatccgggatgaccacatccgcttcatc
tccgagctcgctcgctacagcaacagtgaggtggtgacgggctcagggctggacagccag
aagtcagacgaggagtatcgcgagctcttcgacctagccctgcggggtctgcagcttcta
tccaagtggagcgcccacgtcatggaggtgtactcttggaagctggttcatcccacagac
aagttctgcaacaaggactgtcctggcaccgcggaggaatatgagagagccacacgctac
aattacaccagtgaggaaaaatttgccttcgttgaggtgatcgccatgatcaaaggcctg
caggtgctcatgggcaggatggagagcgtcttcaaccaggccatcaggaacaccatctac
gcggcattgcaggacttcgcccaggtgacgctgcgtgagcccctgcggcaggcggtacgg
aagaagaagaatgtcctcatcagcgtcctacaggcaattcgaaagaccatctgtgactgg
gagggagggcgagagccccctaatgacccatgcttgagaggggagaaggaccccaaaggt
ggatttgatatcaaggtgccccggcgtgctgtggggccatccagcacacagctgtacatg
gtgcggaccatgcttgaatcactcattgcagacaaaagcggctccaagaagaccctgagg
agcagcctggatggacccattgtcctcgccatagaggactttcacaaacagtccttcttc
ttcacacatctgctcaacatcagtgaagccctgcagcagtgttgtgacctctcccagctc
tggttccgagaattcttcctggagttaaccatgggccgacgaatccagttccccatcgag
atgtccatgccctggattctaacggaccatatcctggaaaccaaagaaccttccatgatg
gagtatgtcctctaccctctggatctgtacaacgacagcgcctactatgctctgaccaag
tttaaaaagcagttcctgtacgatgagatagaagctgaggtgaacctgtgttttgatcag
tttgtctacaagctggcagaccagatctttgcttactacaaagccatggctggcagtgtc
ctgttggataaacgttttcgagctgagtgtaagaattatggcgtcatcattccgtatcca
ccgtccaatcgctatgaaacactgctgaagcagagacacgtccagctgttgggtagatca
attgacttgaacagactcattacccagcgcatctctgccgccatgtataaatccttggac
caagctatcagccgctttgagagtgaggacctgacctccattgtggagctggagtggctg
ctggagattaaccggctcacgcatcggctgctctgtaagcatatgacgctggacagcttc
gatgccatgttccgagaggccaatcacaatgtgtccgccccctatggccgtatcaccctg
catgtcttctgggaactgaactttgactttctccccaactactgctacaatgggtccact
aaccgttttgtgcggactgccattcctttcacccaagaaccacaacgagacaaacctgcc
aacgtccagccttattacctctatggatccaagcctctcaacattgcctacagccacatc
tacagctcctacaggaatttcgtggggccacctcatttcaagactatctgcagactcctg
ggttatcagggcatcgctgtggtcatggaggaactgctaaagattgtgaagagcttgctc
caaggaaccattctccagtatgtgaaaacactgatagaggtgatgcccaagatatgccgc
ttgccccgacatgagtatggctccccagggatcctggagttcttccaccaccagctgaag
gacatcattgagtacgcagagctcaaaacagacgtgttccagagcctgagggaagtgggc
aatgccatcctcttctgcctcctcatagagcaagctctgtctcaggaggaggtctgcgat
ttgctccatgccgcacccttccaaaacatcttgcctagagtctacatcaaagagggggag
cgcctggaggtccggatgaaacgtctggaagccaagtatgccccgctccacctggtccct
ctgatcgagcggctggggacccctcagcaaatcgccattgctcgcgagggtgacctcctg
accaaggagcggctgtgctgtggcctgtccatgttcgaggtcatcctgacccgcattcgg
agctacctgcaggaccccatctggcggggcccaccgcccaccaatggcgtcatgcacgtc
gatgagtgtgtggagttccaccggctgtggagcgccatgcagttcgtgtactgcatccct
gtgggaaccaacgagttcacagctgagcagtgtttcggcgatggcttgaactgggctggt
tgctccatcattgtcctgctgggccagcagcgtcgctttgacctgttcgacttctgttac
cacctgctaaaagtgcagaggcaggacgggaaggatgaaatcattaagaatgtgcccctg
aagaagatggccgaccggatcaggaagtatcagatcttgaacaatgaggtttttgccatc
ctgaacaaatacatgaagtccgtggagacagacagttccactgtggagcatgtgcgctgc
ttccagccacccatccaccagtccttggccaccacttgctaa

DBGET integrated database retrieval system