KEGG   Homo sapiens (human): 26999Help
Entry
26999             CDS       T01001                                 

Gene name
CYFIP2, PIR121
Definition
cytoplasmic FMR1 interacting protein 2
Orthology
K05749  
cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    26999 (CYFIP2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    26999 (CYFIP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26999 (CYFIP2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     26999 (CYFIP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q33.3
AA seq 1253 aa AA seqDB search
MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLAD
IVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMVQIRDDHIRFI
SELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIY
AALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKG
GFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFF
FTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMM
EYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSV
LLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLD
QAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITL
HVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHI
YSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICR
LPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCD
LLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLL
TKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIP
VGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPL
KKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcacgtcaccctggaagatgccctgtccaacgtggacctgcttgaagagctt
cccctccccgaccagcagccatgcatcgagcctccaccttcctccatcatgtaccaggct
aactttgacacaaactttgaggacaggaatgcatttgtcacgggcattgcaaggtacatt
gagcaggctacagtccactccagcatgaatgagatgctggaggaaggacatgagtatgcg
gtcatgctgtacacctggcgcagctgttcccgggccattccccaggtgaaatgcaacgag
cagcccaaccgagtagagatctatgagaagacagtagaggtgctggagccggaggtcacc
aagctcatgaagttcatgtattttcagcgcaaggccatcgagcggttctgcagcgaggtg
aagcggctgtgccatgccgagcgcaggaaggactttgtctctgaggcctacctcctgacc
cttggcaagttcatcaacatgtttgctgtcctggatgagctaaagaacatgaagtgcagc
gtcaagaatgaccactctgcctacaagagggcagcacagttcctgcggaagatggcagat
ccccagtctatccaggagtcgcagaacctttccatgttcctggccaaccacaacaggatc
acccagtgtctccaccagcaacttgaagtgatcccaggctatgaggagctgctggctgac
attgtcaacatctgtgtggattactacgagaacaagatgtacctgactcccagtgagaaa
catatgctcctcaaggtgatgggctttggcctctacctaatggatggaaatgtcagtaac
atttacaaactggatgccaagaagagaattaatcttagcaaaattgataaattctttaag
cagctgcaggtggtgccccttttcggcgacatgcagatagagctggccagatacattaag
accagtgctcactatgaagagaacaagtccaagtggacgtgcacccagagcagcatcagc
ccccagtacaatatctgcgagcagatggttcagatccgggatgaccacatccgcttcatc
tccgagctcgctcgctacagcaacagtgaggtggtgacgggctcagggctggacagccag
aagtcagacgaggagtatcgcgagctcttcgacctagccctgcggggtctgcagcttcta
tccaagtggagcgcccacgtcatggaggtgtactcttggaagctggttcatcccacagac
aagttctgcaacaaggactgtcctggcaccgcggaggaatatgagagagccacacgctac
aattacaccagtgaggaaaaatttgccttcgttgaggtgatcgccatgatcaaaggcctg
caggtgctcatgggcaggatggagagcgtcttcaaccaggccatcaggaacaccatctac
gcggcattgcaggacttcgcccaggtgacgctgcgtgagcccctgcggcaggcggtacgg
aagaagaagaatgtcctcatcagcgtcctacaggcaattcgaaagaccatctgtgactgg
gagggagggcgagagccccctaatgacccatgcttgagaggggagaaggaccccaaaggt
ggatttgatatcaaggtgccccggcgtgctgtggggccatccagcacacagctgtacatg
gtgcggaccatgcttgaatcactcattgcagacaaaagcggctccaagaagaccctgagg
agcagcctggatggacccattgtcctcgccatagaggactttcacaaacagtccttcttc
ttcacacatctgctcaacatcagtgaagccctgcagcagtgttgtgacctctcccagctc
tggttccgagaattcttcctggagttaaccatgggccgacgaatccagttccccatcgag
atgtccatgccctggattctaacggaccatatcctggaaaccaaagaaccttccatgatg
gagtatgtcctctaccctctggatctgtacaacgacagcgcctactatgctctgaccaag
tttaaaaagcagttcctgtacgatgagatagaagctgaggtgaacctgtgttttgatcag
tttgtctacaagctggcagaccagatctttgcttactacaaagccatggctggcagtgtc
ctgttggataaacgttttcgagctgagtgtaagaattatggcgtcatcattccgtatcca
ccgtccaatcgctatgaaacactgctgaagcagagacacgtccagctgttgggtagatca
attgacttgaacagactcattacccagcgcatctctgccgccatgtataaatccttggac
caagctatcagccgctttgagagtgaggacctgacctccattgtggagctggagtggctg
ctggagattaaccggctcacgcatcggctgctctgtaagcatatgacgctggacagcttc
gatgccatgttccgagaggccaatcacaatgtgtccgccccctatggccgtatcaccctg
catgtcttctgggaactgaactttgactttctccccaactactgctacaatgggtccact
aaccgttttgtgcggactgccattcctttcacccaagaaccacaacgagacaaacctgcc
aacgtccagccttattacctctatggatccaagcctctcaacattgcctacagccacatc
tacagctcctacaggaatttcgtggggccacctcatttcaagactatctgcagactcctg
ggttatcagggcatcgctgtggtcatggaggaactgctaaagattgtgaagagcttgctc
caaggaaccattctccagtatgtgaaaacactgatagaggtgatgcccaagatatgccgc
ttgccccgacatgagtatggctccccagggatcctggagttcttccaccaccagctgaag
gacatcattgagtacgcagagctcaaaacagacgtgttccagagcctgagggaagtgggc
aatgccatcctcttctgcctcctcatagagcaagctctgtctcaggaggaggtctgcgat
ttgctccatgccgcacccttccaaaacatcttgcctagagtctacatcaaagagggggag
cgcctggaggtccggatgaaacgtctggaagccaagtatgccccgctccacctggtccct
ctgatcgagcggctggggacccctcagcaaatcgccattgctcgcgagggtgacctcctg
accaaggagcggctgtgctgtggcctgtccatgttcgaggtcatcctgacccgcattcgg
agctacctgcaggaccccatctggcggggcccaccgcccaccaatggcgtcatgcacgtc
gatgagtgtgtggagttccaccggctgtggagcgccatgcagttcgtgtactgcatccct
gtgggaaccaacgagttcacagctgagcagtgtttcggcgatggcttgaactgggctggt
tgctccatcattgtcctgctgggccagcagcgtcgctttgacctgttcgacttctgttac
cacctgctaaaagtgcagaggcaggacgggaaggatgaaatcattaagaatgtgcccctg
aagaagatggccgaccggatcaggaagtatcagatcttgaacaatgaggtttttgccatc
ctgaacaaatacatgaagtccgtggagacagacagttccactgtggagcatgtgcgctgc
ttccagccacccatccaccagtccttggccaccacttgctaa

DBGET integrated database retrieval system