KEGG   Homo sapiens (human): 27Help
Entry
27                CDS       T01001                                 

Gene name
ABL2, ABLL, ARG
Definition
(RefSeq) ABL proto-oncogene 2, non-receptor tyrosine kinase (EC:2.7.10.2)
  KO
K08887  
abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    27 (ABL2)
   04012 ErbB signaling pathway
    27 (ABL2)
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    27 (ABL2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     27 (ABL2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Abl family
   27 (ABL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25.2
AA seq 1182 aa AA seqDB search
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGG
SFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPR
SNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEES
AAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLG
MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQE
GGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKIS
ADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAV
SKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaagctccggggctccagcagcctcagccccgc
gggatccggggcagcagtgcagccaggccctccggccgcaggcgggacccggcggggcgc
accacagagaccggcttcaatatcttcacccagcatgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagctttgcatcgtccctat
ggttgtgatgttgaaccccaggcactaaatgaggctatcaggtggagctccaaggagaac
ttgctcggagccactgagagtgaccctaatctcttcgttgcactttatgattttgtagca
agtggtgataacacactcagcatcactaaaggtgaaaagctacgagtccttggttacaac
cagaatggtgagtggagtgaagttcgctctaagaatgggcagggctgggtgccaagcaac
tacatcaccccagtgaacagcctggaaaaacactcctggtaccatggacctgtgtcacgc
agtgcagctgagtatctgctcagcagtctaatcaatggcagcttcctggtgcgagaaagt
gagagtagccctgggcagctgtccatctcgctcaggtacgagggacgtgtgtatcactac
aggatcaataccactgcagatggcaaggtgtatgtgactgctgagagccgcttcagcacc
ttggcagagcttgtacaccatcactccacagtggctgatgggctggtgacaacattacac
tacccagcacccaagtgtaataagcctacagtctatggtgtgtcccccatccacgacaaa
tgggaaatggagcgaacagatattaccatgaagcacaaacttgggggcggtcagtatgga
gaggtttacgttggcgtctggaagaaatacagccttacagttgctgtgaaaacattgaag
gaagataccatggaggtagaagaattcctgaaagaagctgcagtaatgaaggaaatcaag
catcctaatctggtacaacttttaggtgtgtgtactttggagccaccattttacattgtg
actgaatacatgccatacgggaatttgctggattacctccgagaatgcaaccgagaagag
gtgactgcagttgtgctgctctacatggccactcagatttcttctgcaatggagtactta
gagaagaagaatttcatccatagagatcttgcagctcgtaactgcctagtgggagaaaac
catgtggtaaaagtggctgactttggcttaagtagattgatgactggagacacttatact
gctcatgctggagccaaatttcctattaagtggacagcaccagagagtcttgcctacaat
accttctcaattaaatctgacgtctgggcttttggggtattgttgtgggaaattgctacc
tatggaatgtcaccatatccaggtattgacctgtctcaggtctatgacctactagaaaaa
ggatatcgaatggaacagcctgagggatgcccccctaaggtttatgaacttatgagagca
tgctggaagtggagccctgccgataggccctcttttgctgaaacacaccaagcttttgaa
accatgttccatgactccagcatttctgaagaggtagctgaggagcttgggagagccgcc
tcctcgtcatctgttgttccatacctgccccggctacctatacttccttccaagactcgg
acactgaagaaacaggtggagaacaaggagaacattgaaggggcacaagatgccacagaa
aattctgcttccagtttagcaccagggttcatcagaggtgcacaggcctctagtggatcc
ccagcactgcctcgaaagcaaagagacaagtcacccagcagcctcttggaagatgccaaa
gagacatgcttcaccagggataggaaggggggcttcttcagctccttcatgaagaagaga
aatgctcctacaccccccaaacgcagcagctccttccgagaaatggagaatcagccccat
aagaaatacgaactcacgggtaacttctcatctgttgcttctctacagcatgctgatggg
ttctctttcactcctgcccagcaagaggcgaatctggtgccacccaagtgctatgggggg
agctttgcacagaggaacctctgtaatgacgacggtggtgggggtgggggcagtggcact
gctgggggtgggtggtctggcatcacaggcttctttacaccacgcttaatcaaaaagaca
ctgggcttacgagcaggtaaacccacagccagtgatgacacttccaagccttttccaagg
tcaaactctacatcttccatgtcctcagggcttccagagcaggataggatggcaatgacc
cttcccaggaactgccagaggtccaaactccagctggaaaggacagtgtccacctcttct
cagccagaagagaatgtggacagggccaatgacatgcttccaaaaaaatcagaggaaagt
gctgctccaagcagggagagaccaaaagccaagttattgcccagaggagccacagctctt
cctctcagaacaccctctggggatctagccattacagagaaggaccctccaggggtggga
gtggctggagtggcagctgcccccaagggtaaagagaagaatggtggggcacgacttggg
atggctggagttccagaggatggagagcagccgggctggccttctccagccaaggctgcc
cccgtcctcccaaccactcacaaccacaaagtgccagtccttatctcacccactctgaaa
cacactccagctgacgtgcagctcattggcacagactctcaggggaataaattcaagctc
ttatctgagcatcaggtcacatcctctggagacaaggaccgaccccgacgggtaaaacca
aagtgtgccccacccccaccaccagtgatgagactactgcagcatccgtccatctgctca
gaccctacagaagagccaactgccctaactgcaggacagtccacatcagaaacacaggaa
ggaggaaagaaggcagctctgggcgcagtgcccatcagtgggaaagctgggaggccagtg
atgcctccacctcaagtgcctctgcccacatcttccatctcgccagccaaaatggccaat
ggcacagcaggtactaaagtggctctgagaaaaaccaaacaggccgctgagaaaatctca
gcagacaaaatcagcaaagaggccctgctggaatgtgctgacctactgtccagtgcactc
acggaacctgtgcccaacagccagctggtagacactggacaccagctgcttgactactgc
tcaggctatgtggactgcatccctcaaactcgcaacaaatttgccttccgagaggctgtg
agcaaactggaactcagcctgcaggagctacaggtttcttcagcagctgctggtgtgccc
gggacaaaccctgtccttaataacttattgtcatgtgtacaggaaatcagtgatgtggtg
cagaggtag

DBGET integrated database retrieval system