KEGG   Homo sapiens (human): 270Help
Entry
270               CDS       T01001                                 

Gene name
AMPD1, MAD, MADA, MMDD
Definition
adenosine monophosphate deaminase 1 (EC:3.5.4.6)
Orthology
K01490  
AMP deaminase [EC:3.5.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    270 (AMPD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     270 (AMPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13
AA seq 780 aa AA seqDB search
MNVRIFYSVSQSPHSLLSLLFYCAILESRISATMPLFKLPAEEKQIDDAMRNFAEKVFAS
EVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIP
LSETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIR
EKYMQKSFQRFPKTPSKYLRNIDGEAWVANESFYPVFTPPVKKGEDPFRTDNLPENLGYH
LKMKDGVVYVYPNEAAVSKDEPKPLPYPNLDTFLDDMNFLLALIAQGPVKTYTHRRLKFL
SSKFQVHQMLNEMDELKELKNNPHRDFYNCRKVDTHIHAAACMNQKHLLRFIKKSYQIDA
DRVVYSTKEKNLTLKELFAKLKMHPYDLTVDSLDVHAGRQTFQRFDKFNDKYNPVGASEL
RDLYLKTDNYINGEYFATIIKEVGADLVEAKYQHAEPRLSIYGRSPDEWSKLSSWFVCNR
IHCPNMTWMIQVPRIYDVFRSKNFLPHFGKMLENIFMPVFEATINPQADPELSVFLKHIT
GFDSVDDESKHSGHMFSSKSPKPQEWTLEKNPSYTYYAYYMYANIMVLNSLRKERGMNTF
LFRPHCGEAGALTHLMTAFMIADDISHGLNLKKSPVLQYLFFLAQIPIAMSPLSNNSLFL
EYAKNPFLDFLQKGLMISLSTDDPMQFHFTKEPLMEEYAIAAQVFKLSTCDMCEVARNSV
LQCGISHEEKVKFLGDNYLEEGPAGNDIRRTNVAQIRMAYRYETWCYELNLIAEGLKSTE
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcaggatattttatagtgtcagtcagtcaccccacagtctcctctctcttctt
ttctactgtgctatcctagaatcaaggatttcagcaacaatgcctctgttcaaactccca
gctgaagagaaacaaattgatgatgcaatgcgcaactttgctgaaaaagtgtttgcctct
gaagtcaaagatgaaggaggtcgtcaggagatttccccctttgatgtggatgagatctgt
ccgatttctcatcatgagatgcaagcacacatattccatctggagactctgtccacctcc
acagaagccaggagaaaaaagcgtttccaaggacggaagactgttaatttgtccattcca
ctaagtgaaacatcttccaccaaactgtcccacattgatgaatacatttcctcatctcca
acctaccagaccgtgcctgattttcagagagtgcagattactggtgactatgcctctggg
gttacagttgaagattttgaaattgtttgcaaaggtctgtatcgggcactatgcatacgt
gagaaatacatgcagaagtcgtttcagaggttccctaaaaccccttccaaatacttgcgg
aacattgatggtgaggcttgggtagcaaatgagagcttctatccagtctttactcctcct
gtgaagaagggagaggaccccttccgaacagacaaccttcctgaaaacctgggctatcac
ctcaaaatgaaggacggtgtagtttacgtctatcctaatgaagcagcagtcagcaaagat
gagcctaagccacttccttacccaaatctggacaccttcttagacgatatgaatttttta
cttgctttaattgctcaaggacctgttaagacctatacccaccggcgcctgaagttcctc
tcctccaagttccaggtccatcagatgcttaacgagatggacgagttaaaggagctgaaa
aacaacccccaccgagatttttataactgcaggaaggtggacacccatatccatgcagcc
gcttgcatgaaccagaaacatctgctgcgttttattaagaaatcttaccaaattgatgct
gacagagtggtctatagcaccaaagagaagaatctgaccctaaaggaactttttgctaaa
ttaaaaatgcatccttatgacctgactgttgattctctggatgttcatgctggacgccag
accttccagcgttttgataagttcaatgacaaatataatcctgtaggagcaagtgagcta
cgggacctctacttgaagacagacaattacattaatggggaatattttgccactatcatc
aaggaggtaggtgcggacctggtggaggccaagtaccagcatgctgagccccgcctgtcc
atctatggccgcagtcctgatgagtggagcaaactctcctcctggttcgtctgcaatcgc
atccactgccccaacatgacatggatgatccaggttcccaggatctatgatgtgttccgt
tccaagaatttccttccacattttggaaaaatgctggagaatattttcatgccagtgttt
gaggccaccatcaacccccaggctgacccagaactcagtgtcttcctcaagcatatcact
ggctttgacagtgtggatgatgagtccaaacacagtggccacatgttctcctccaagagt
cccaagccccaggagtggacattggaaaagaatccatcttacacttactatgcctactac
atgtatgcaaacatcatggtgctcaacagcctgagaaaggaacgaggcatgaatacgttt
ctgttccgacctcactgtggagaagctggagccctcacccatctcatgacagcattcatg
atagcagatgatatctctcatggcctaaatttaaaaaagagtcccgtgctacagtacttg
tttttcttagcccaaattcccatcgccatgtcaccactaagtaacaatagcctatttcta
gagtatgccaaaaatccttttttggatttccttcagaaagggctaatgatctcactgtct
acagatgacccaatgcaattccactttaccaaggagcccctaatggaagaatatgctatt
gctgcacaagtcttcaagctgagcacctgtgatatgtgcgaagtggcaaggaacagtgtc
ttgcagtgtggaatttctcatgaggagaaagtaaagtttctgggcgacaattaccttgag
gaaggccctgctggaaatgatatccggaggacaaatgtagcccaaatccgcatggcctat
cgctatgaaacctggtgttatgaactcaatttaattgctgagggtcttaaatcaacagaa
taa

DBGET integrated database retrieval system