KEGG   Homo sapiens (human): 27006Help
Entry
27006             CDS       T01001                                 

Gene name
FGF22
Definition
fibroblast growth factor 22
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    27006 (FGF22)
   04015 Rap1 signaling pathway
    27006 (FGF22)
   04010 MAPK signaling pathway
    27006 (FGF22)
   04151 PI3K-Akt signaling pathway
    27006 (FGF22)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    27006 (FGF22)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    27006 (FGF22)
   05205 Proteoglycans in cancer
    27006 (FGF22)
   05218 Melanoma
    27006 (FGF22)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  27006 (FGF22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 170 aa AA seqDB search
MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR
VQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIE
ENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgccgcctgtggctgggcctggcctggctgctgctggcgcgggcgccggacgcc
gcgggaaccccgagcgcgtcgcggggaccgcgcagctacccgcacctggagggcgacgtg
cgctggcggcgcctcttctcctccactcacttcttcctgcgcgtggatcccggcggccgc
gtgcagggcacccgctggcgccacggccaggacagcatcctggagatccgctctgtacac
gtgggcgtcgtggtcatcaaagcagtgtcctcaggcttctacgtggccatgaaccgccgg
ggccgcctctacgggtcgcgactctacaccgtggactgcaggttccgggagcgcatcgaa
gagaacggccacaacacctacgcctcacagcgctggcgccgccgcggccagcccatgttc
ctggcgctggacaggaggggggggccccggccaggcggccggacgcggcggtaccacctg
tccgcccacttcctgcccgtcctggtctcctga

DBGET integrated database retrieval system