KEGG   Homo sapiens (human): 27020Help
Entry
27020             CDS       T01001                                 

Gene name
NPTN, GP55, GP65, SDFR1, SDR1, np55, np65
Definition
(RefSeq) neuroplastin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22
AA seq 398 aa AA seqDB search
MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTP
EIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASN
DPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLT
YSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDI
TGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTEL
NIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVY
EKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgtcgctgcccagcgccctggccctctcgctgttgctggtctctggctcc
ctcctcccagggccaggcgccgctcagaacgctgggtttgtcaagtcgcccatgtcagaa
actaagctcacgggggacgcctttgagctgtactgtgacgtggtcgggagccccacgcca
gagatccagtggtggtacgcagaagtcaaccgggcagagtctttcagacagctgtgggac
ggtgctcggaagcgccgtgtcaccgtaaacaccgcctacgggtcaaacggcgtgagtgtg
ctgagaataacccggctcaccttggaggactctgggacttacgagtgcagggccagcaac
gaccccaagaggaatgacttgaggcaaaacccctccataacatggattcgagcccaggcc
accataagcgtccttcagaagccaaggattgtcaccagtgaagaggtcattattcgagac
agccctgttctccctgtcaccctgcagtgtaacctcacctccagctctcacacccttaca
tacagctactggacaaagaatggggtggaactgagtgccactcgtaagaatgccagcaac
atggagtacaggatcaataagccgagagctgaggattcaggcgaataccactgcgtatat
cactttgtcagcgctcctaaagcaaacgccaccattgaagtgaaagccgctcctgacatc
actggccataaacggagtgagaacaagaatgaagggcaggatgccactatgtattgcaag
tcagttggctacccccacccagactggatatggcgcaagaaggagaacgggatgcccatg
gacattgtcaatacctctggccgcttcttcatcatcaacaaggaaaattacactgagttg
aacattgtgaacctgcagatcacggaagaccctggcgagtatgaatgtaatgccaccaac
gccattggctccgcctctgttgtcactgtcctcagggtgcggagccacctggccccactc
tggcctttcttgggaattctggctgaaattatcatccttgtggtgatcattgttgtgtat
gagaagaggaagaggccagatgaggttcctgacgatgatgaaccagctggaccaatgaaa
accaactctaccaacaatcacaaagataaaaacttgcgccagagaaacacaaattaa

DBGET integrated database retrieval system