KEGG   Homo sapiens (human): 27034Help
Entry
27034             CDS       T01001                                 

Gene name
ACAD8, ACAD-8, ARC42
Definition
acyl-CoA dehydrogenase family, member 8
Orthology
K11538  
isobutyryl-CoA dehydrogenase [EC:1.3.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Disease
H01279  
Isobutyryl-CoA dehydrogenase (IBD) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    27034 (ACAD8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.-  
     27034 (ACAD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q25
AA seq 415 aa AA seqDB search
MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREM
APNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTT
AYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQG
DHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNS
QPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLN
VRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATD
ECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggagcggctgccggcgtttcggggcgcgcctcggctgcctgcccggcggtctc
cgggtcctcgtccagaccggccaccggagcttgacctcctgcatcgacccttccatggga
cttaatgaagagcagaaagaatttcaaaaagtggcctttgactttgctgcccgagagatg
gctccaaatatggcagagtgggaccagaaggagctgttcccagtggatgtgatgcggaag
gcagcccagctaggcttcggaggggtctacatacaaacagatgtgggcgggtctgggctg
tcacgtcttgatacctctgtcatttttgaagccttggctacaggctgcaccagcaccaca
gcctatataagcatccacaacatgtgtgcctggatgattgatagcttcggaaatgaggaa
cagaggcacaaattttgcccaccgctctgtaccatggagaagtttgcttcctactgcctc
actgaaccaggaagtgggagtgatgctgcctctcttctgacctccgctaagaaacaggga
gatcattacatcctcaatggctccaaggccttcatcagtggtgctggtgagtcagacatc
tatgtggtcatgtgccgaacaggaggaccaggccccaagggcatctcatgcatagttgtt
gagaaggggacccctggcctcagctttggcaagaaggagaaaaaggtggggtggaactcc
cagccaacacgagctgtgatcttcgaagactgtgctgtccctgtggccaacagaattggg
agcgaggggcagggcttcctcattgccgtgagaggactgaacggagggaggatcaatatt
gcttcctgctccctgggggctgcccacgcctctgtcatcctcacccgagaccacctcaat
gtccggaagcagtttggagagcctctggccagtaaccagtacttgcaattcacactggct
gatatggcaacaaggctggtggccgcgcggctgatggtccgcaatgcagcagtggctctg
caggaggagaggaaggatgcagtggccttgtgctccatggccaagctctttgctacagat
gaatgctttgccatctgcaaccaggccttgcagatgcacgggggctacggctacctgaag
gattacgctgttcagcagtacgtgcgggactccagggtccaccagattctagaaggtagc
aatgaagtgatgaggatactgatctctagaagcctgcttcaggagtag

DBGET integrated database retrieval system