KEGG   Homo sapiens (human): 27037Help
Entry
27037             CDS       T01001                                 

Gene name
TRMT2A, HTF9C
Definition
(RefSeq) tRNA methyltransferase 2 homolog A
  KO
K15332  
tRNA (uracil-5-)-methyltransferase [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     27037 (TRMT2A)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    27037 (TRMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 625 aa AA seqDB search
MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLY
SYIRDDLFTSEIFKLELQNVPRHASFSDVRRFLGRFGLQPHKTKLFGQPPCAFVTFRSAA
ERDKALRVLHGALWKGRPLSVRLARPKADPMARRRRQEGESEPPVTRVADVVTPLWTVPY
AEQLERKQLECEQVLQKLAKEIGSTNRALLPWLLEQRHKHNKACCPLEGVRPSPQQTEYR
NKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVVKAFQEFIRSTP
YSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRA
SGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVL
YTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELS
NVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNP
RAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGP
HSPPAQPTPGPPDNTLQETGTFPSS
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacctcgacaacgagggcccgaagcccatggagagctgtggccaggagagc
agcagtgccctgagctgccctaccgtctcggtgccccctgcagccccggcagccctggag
gaggtggagaaagagggcgctggggcggctacagggccggggcctcagcccgggctctac
agctacatcagggatgacttgtttacctctgagatctttaaactggagctgcagaacgtg
cctcgccacgccagcttcagcgacgtccggcgcttcctgggccgctttggtctgcagccc
cacaaaaccaaactctttgggcaaccaccctgcgcctttgtgacattccgcagcgctgca
gagagggacaaggccctgcgcgttttgcatggtgccctctggaaaggccgcccactcagt
gtgcgcctggcccggcccaaggccgaccccatggccaggaggaggcgacaggagggtgag
agtgagccaccagtaacacgagtggccgacgtggtgacccctctatggacagtgccctat
gctgagcagcttgagcggaagcagctggagtgcgagcaggtgctgcagaaacttgccaag
gaaatcgggagcaccaaccgtgccttgctgccctggctgctcgagcagaggcacaagcac
aacaaggcctgctgcccgctggagggggtcaggccatcaccccagcagactgagtatcgt
aataagtgtgagtttctggttggcgtcggggtggatggggaggataacaccgtgggctgt
cggctcggcaagtacaagggcgggacgtgtgctgtggcagccccgtttgacaccgtgcac
atccccgaagccaccaagcaggtggtgaaggccttccaggagttcatccggtccactcca
tactcggcatacgacccagagacgtacacaggccactggaagcagctgactgtgcgcacc
agccgccgccaccaggccatggccattgcctacttccacccccagaagctgagccctgag
gagctggcagagctgaagacctccctagcgcagcacttcacagcagggccaggcagggcc
agtggagtgacctgcctctacttcgtggaggagggacagcgaaagactcctagccaggag
ggcctgcccctggagcatgtggctggggaccggtgcatccacgaggacctgctagggctg
accttccggatctctccacacgccttcttccaggtgaacacacccgcagccgaggtgctc
tacacagtcatccaggactgggcccaattggatgcggggagcatggtgctggacgtgtgc
tgtggcaccggcaccattggcctggccctggcccggaaggtaaagagggtcattggggtc
gagctatgcccagaggctgtggaggacgcccgggtgaacgcccaggacaatgagttgagt
aatgtggagttccactgcgggagggccgaggacctggtgcccaccctggtgagcagactg
gcctcccagcacctcgtggccatcctggacccaccccgtgctggcttgcattccaaggtg
atcctggccatccggagagctaagaacctcaggcggctgctgtacgtctcatgcaacccc
cgggcagccatgggcaactttgtggacctctgcagagccccatctaaccgggtgaagggc
attcccttccggccggtcaaggctgtggcagtggacctgttcccgcagaccccgcactgt
gagatgctcatcctgtttgagagggtggagcaccccaatggcacaggggtcttggggccc
cacagccctccagctcaacccacaccaggacccccagataacaccctacaagaaactggg
accttcccctcatcctag

DBGET integrated database retrieval system