KEGG   Homo sapiens (human): 27044Help
Entry
27044             CDS       T01001                                 

Gene name
SND1, TDRD11, p100
Definition
staphylococcal nuclease and tudor domain containing 1
Orthology
K15979  
staphylococcal nuclease domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    27044 (SND1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    27044 (SND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31.3
AA seq 910 aa AA seqDB search
MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
RRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTI
ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSET
PEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKL
NSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
MDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAH
YEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIAS
HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTL
SPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
DDADEFGYSR
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctccgcgcagagcggcggctcctccgggggacccgcggtccccaccgtgcag
cggggcatcatcaagatggtcctctcagggtgcgccatcattgtccgaggtcagcctcgt
ggtgggcctcctcctgagcggcagatcaacctcagcaacattcgtgctggaaatcttgct
cgccgggcagccgccacacaacctgatgcaaaggatacccctgatgagccctgggcattt
ccagctcgagagttccttcgaaagaagctgattgggaaggaagtctgtttcacgatagaa
aacaagactccccaggggcgagagtatggcatgatctaccttggaaaagataccaatggg
gaaaacattgcagaatcactggttgcagagggcttagccacccggagagaaggcatgaga
gctaataatcctgagcagaaccggctttcagaatgtgaagaacaagcaaaggcagccaag
aaagggatgtggagtgaggggaacggttcacatactatccgggatctcaagtataccatt
gaaaacccaaggcactttgtggactcacaccaccagaagcctgttaatgctatcatcgag
catgtgcgggacggcagtgtggtcagggccctgctcctcccagattactacctggttaca
gtcatgctgtcaggcatcaagtgcccaacttttcgacgggaagcagatggcagtgaaact
ccagagccttttgctgcagaagccaaatttttcactgagtcgcgactgcttcagagagat
gttcagatcattctggagagctgccacaaccagaacattctgggtaccatccttcatcca
aatggcaacatcacagagctcctcctgaaggaaggtttcgcacgctgtgtggactggtcg
attgcagtttacacccggggcgcagaaaagctgagggcggcagagaggtttgccaaagag
cgcaggctgagaatatggagagactatgtggctcccacagctaatttggaccaaaaggac
aagcagtttgttgccaaggtgatgcaggttctgaatgctgatgccattgttgtgaagctg
aactcaggcgattacaagacgattcacctgtccagcatccgaccaccgaggctggagggg
gagaacacccaggataagaacaagaaactgcgtcccctgtatgacattccttacatgttt
gaggcccgggaatttcttcgaaaaaagcttattgggaagaaggtcaatgtgacggtggac
tacattagaccagccagcccagccacagagacagtgcctgccttttcagagcgtacctgt
gccactgtcaccattggaggaataaacattgctgaggctcttgtcagcaaaggtctagcc
acagtgatcagataccggcaggatgatgaccagagatcatcacactacgatgaactgctt
gctgcagaggccagagctattaagaatggcaaaggattgcatagcaagaaggaagtgcct
atccaccgtgttgcagatatatctggggatacccaaaaagcaaagcagttcctgcctttt
cttcagcgggcaggtcgttctgaagctgtggtggaatacgtcttcagtggttctcgtctc
aaactctatttgccaaaggaaacttgccttatcaccttcttgcttgcaggcattgaatgc
cccagaggagcccgaaacctcccaggcttggtgcaggaaggagagcccttcagcgaggaa
gctacacttttcaccaaggaactggtgctgcagcgagaggtggaggtggaggtggagagc
atggacaaggccggcaactttatcggctggctgcacatcgacggtgccaacctgtccgtc
ctgctggtggagcacgcgctctccaaggtccacttcaccgccgaacgcagctcctactac
aagtccctgctgtctgccgaggaggccgcaaagcagaagaaagagaaggtctgggcccac
tatgaggagcagcccgtggaggaggtgatgccagtgctggaggagaaggagcgatctgct
agctacaagcccgtgtttgtgactgagatcactgatgacctgcacttctacgtgcaggat
gtggagaccggcacccagttggagaagctgatggagaacatgcgcaatgacattgccagt
cacccccctgtagagggctcctatgccccccgcaggggagagttctgcattgccaaattt
gtagatggagaatggtaccgtgcccgagtagagaaagtcgagtctcctgccaaaatacat
gtcttctacattgactacggcaacagagaggtcctgccatccacccgcctgggtacccta
tcacctgccttcagcactcgggtgctgccagctcaagccacggagtatgccttcgccttc
atccaggtgccccaagatgatgatgcccgcacggacgccgtggacagcgtagttcgggat
atccagaacactcagtgcctgctcaacgtggaacacctgagtgccggctgcccccatgtc
accctgcagtttgcagattccaagggcgatgtggggctgggcttggtgaaggaagggctg
gtcatggtggaggtgcgcaaggagaaacagttccagaaagtgatcacagaatacctgaat
gcccaagagtcagccaagagcgccaggctgaacctgtggcgctatggagactttcgagct
gatgatgcagacgaatttggctacagccgctaa

DBGET integrated database retrieval system