KEGG   Homo sapiens (human): 27071Help
Entry
27071             CDS       T01001                                 

Gene name
DAPP1, BAM32
Definition
dual adaptor of phosphotyrosine and 3-phosphoinositides
Orthology
K12229  
dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
Organism
hsa  Homo sapiens (human)
Pathway
B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    27071 (DAPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q25-q27
AA seq 280 aa AA seqDB search
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagcagaacttctagaagggaagatgagcacccaggatccctcagatctgtgg
agcagatccgatggagaggctgagctgctccaggacttggggtggtatcacggcaacctc
acacgccatgctgctgaagctcttctcctctcaaatggatgtgacggcagctaccttctg
agggacagcaatgagaccaccgggctgtactctctctctgtgagggccaaagattctgtt
aaacactttcatgttgaatatactggatattcatttaaatttggctttaatgaattctca
tctttgaaggattttgtcaagcattttgcaaatcagcctttgattggaagcgagacaggc
actctgatggttctaaaacatccctacccaagaaaagtggaagaaccctccatttatgaa
tctgtccgggttcacacagcaatgcagacaggaagaacagaagatgaccttgtgcccaca
gcaccttctctgggcaccaaagaaggttacctcaccaaacagggaggcctggtcaagacc
tggaaaacaagatggtttactctgcacaggaatgaactgaaatacttcaaagaccagatg
tcaccagaaccaattcggatcctagacctaacagaatgttcagctgtacaattcgattat
tcacaagaaagggtaaactgtttttgtttggtatttccattcaggacattttatctctgt
gcaaagaccggagtagaagctgatgagtggatcaagatattacgctggaaattgtcacaa
ataagaaaacagctcaaccaaggggaaggcacgatccgatctcggtcgttcatctttaaa
tag

DBGET integrated database retrieval system