KEGG   Homo sapiens (human): 27074Help
Entry
27074             CDS       T01001                                 

Gene name
LAMP3, CD208, DC_LAMP, DC-LAMP, DCLAMP, LAMP, LAMP-3, TSC403
Definition
(RefSeq) lysosomal associated membrane protein 3
  KO
K06562  
lysosomal-associated membrane protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    27074 (LAMP3)
Cellular antigens [BR:hsa04090]
 Proteins
  27074 (LAMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9UQV4(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q27.1
AA seq 416 aa AA seqDB search
MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAP
HQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPV
TEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKST
TGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKA
EMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEES
YYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQL
QAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccccggcagctcagcgcggcggccgcgctcttcgcgtccctggccgtaattttgcac
gatggcagtcaaatgagagcaaaagcatttccagaaaccagagattattctcaacctact
gcagcagcaacagtacaggacataaaaaaacctgtccagcaaccagctaagcaagcacct
caccaaactttagcagcaagattcatggatggtcatatcacctttcaaacagcggccaca
gtaaaaattccaacaactaccccagcgactacaaaaaacactgcaaccaccagcccaatt
acctacaccctggtcacaacccaggccacacccaacaactcacacacagctcctccagtt
actgaagttacagtcggccctagcttagccccttattcactgccacccaccatcacccca
ccagctcatacaactggaaccagttcatcaaccgtcagccacacaactgggaacaccact
caacccagtaaccagaccacccttccagcaactttatcgatagcactgcacaaaagcaca
accggtcagaagcctgttcaacccacccatgccccaggaacaacggcagctgcccacaat
accacccgcacagctgcacctgcctccacggttcctgggcccacccttgcacctcagcca
tcgtcagtcaagactggaatttatcaggttctaaacggaagcagactctgtataaaagca
gagatggggatacagctgattgttcaagacaaggagtcggttttttcacctcggagatac
ttcaacatcgaccccaacgcaacgcaagcctctgggaactgtggcacccgaaaatccaac
cttctgttgaattttcagggcggatttgtgaatctcacatttaccaaggatgaagaatca
tattatatcagtgaagtgggagcctatttgaccgtctcagatccagagacaatttaccaa
ggaatcaaacatgcggtggtgatgttccagacagcagtcgggcattccttcaagtgcgtg
agtgaacagagcctccagttgtcagcccacctgcaggtgaaaacaaccgatgtccaactt
caagcctttgattttgaagatgaccactttggaaatgtggatgagtgctcgtctgactac
acaattgtgcttcctgtgattggggccatcgtggttggtctctgccttatgggtatgggt
gtctataaaatccgcctaaggtgtcaatcatctggataccagagaatctaa

DBGET integrated database retrieval system