KEGG   Homo sapiens (human): 27089Help
Entry
27089             CDS       T01001                                 

Gene name
UQCRQ, MC3DN4, QCR8, QP-C, QPC, UQCR7
Definition
ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (EC:1.10.2.2)
Orthology
K00418  
ubiquinol-cytochrome c reductase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
5q31.1
AA seq 82 aa AA seqDB search
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcgagtttgggaatctgacgcggatgcggcatgtgatcagctacagcttgtca
ccgttcgagcagcgcgcctatccgcacgtcttcactaaaggaatccccaatgttctgcgc
cgcattcgggagtctttctttcgcgtggtgccgcagtttgtagtgttttatcttatctac
acatgggggactgaagagttcgagagatccaagaggaagaatccagctgcctatgaaaat
gacaaatga

DBGET integrated database retrieval system