KEGG   Homo sapiens (human): 27089Help
Entry
27089             CDS       T01001                                 

Gene name
UQCRQ, MC3DN4, QCR8, QP-C, QPC, UQCR7
Definition
ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (EC:1.10.2.2)
Orthology
K00418  
ubiquinol-cytochrome c reductase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    27089 (UQCRQ)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    27089 (UQCRQ)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    27089 (UQCRQ)
   05012 Parkinson's disease
    27089 (UQCRQ)
   05016 Huntington's disease
    27089 (UQCRQ)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    27089 (UQCRQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
5q31.1
AA seq 82 aa AA seqDB search
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcgagtttgggaatctgacgcggatgcggcatgtgatcagctacagcttgtca
ccgttcgagcagcgcgcctatccgcacgtcttcactaaaggaatccccaatgttctgcgc
cgcattcgggagtctttctttcgcgtggtgccgcagtttgtagtgttttatcttatctac
acatgggggactgaagagttcgagagatccaagaggaagaatccagctgcctatgaaaat
gacaaatga

DBGET integrated database retrieval system