KEGG   Homo sapiens (human): 27092Help
Entry
27092             CDS       T01001                                 

Gene name
CACNG4
Definition
calcium channel, voltage-dependent, gamma subunit 4
Orthology
K04869  
voltage-dependent calcium channel gamma-4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    27092 (CACNG4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    27092 (CACNG4)
  Circulatory system
   04260 Cardiac muscle contraction
    27092 (CACNG4)
   04261 Adrenergic signaling in cardiomyocytes
    27092 (CACNG4)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    27092 (CACNG4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    27092 (CACNG4)
   05414 Dilated cardiomyopathy (DCM)
    27092 (CACNG4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   27092 (CACNG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24
AA seq 327 aa AA seqDB search
MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGD
LTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLL
GGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYN
YGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRR
RRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEASF
LQVHDFFQQDLKEGFHVSMLNRRTTPV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgatgcgaccgcgggctgcagatgctgctgaccacggccggagccttcgccgcc
ttctcgctcatggccatcgccatcggcaccgactactggctgtactccagcgcgcacatc
tgcaacggcaccaacctgaccatggacgacgggcccccgccccgccgcgcccgcggcgac
ctcacccactctggtctgtggcgggtgtgctgcatcgaagggatctataaagggcactgc
ttccggatcaatcacttcccagaggacaatgactacgaccacgacagctcggagtacctc
ctccgcatcgtgcgagcctccagcgtcttccccatcctcagcaccatcctgctcctgctg
ggtggcctgtgcatcggtgctggcaggatctacagccgcaagaacaacatcgtcctcagt
gccggcatcctcttcgtggctgcaggcctcagtaacatcatcggtatcatcgtctacatt
tccagcaacacaggtgacccgagtgacaagcgggacgaagacaaaaagaaccattacaac
tacggctggtctttttactttggagctctgtctttcattgtggctgagaccgtgggcgtc
ctggctgtaaacatttacattgagaaaaataaagagttgaggtttaagaccaaacgggaa
ttccttaaggcgtcttcctcttctccttatgccaggatgccgagctacaggtaccggcga
cggcgctcgaggtccagctcaaggtccaccgaggcctcgccctccagggacgtgtcgccc
atgggcctgaagatcacaggggccatccccatgggggagctgtccatgtacacgctgtcc
agggagcccctcaaggtgaccaccgcagccagctacagccccgaccaggaggccagcttc
ctgcaggtgcatgactttttccagcaggacctgaaggaaggtttccacgtcagcatgctg
aaccgacggacgacccctgtgtga

DBGET integrated database retrieval system