KEGG   Homo sapiens (human): 2710Help
Entry
2710              CDS       T01001                                 

Gene name
GK, GK1, GKD
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Disease
H00552  
Glycerol kinase deficiency (GKD)
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp21.3
AA seq 524 aa AA seqDB search
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcaaagaaggcagttttggggccattggtgggggcggtggaccagggcacc
agttcgacgcgctttttggttttcaattcaaaaacagctgaactacttagtcatcatcaa
gtagaaataaaacaagagttcccaagagaaggatgggtggaacaggaccctaaggaaatt
ctacattctgtctatgagtgtatagagaaaacatgtgagaaacttggacagctcaatatt
gatatttccaacataaaagctattggtgtcagcaaccagagggaaaccactgtagtctgg
gacaagataactggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
tctaccgttgagagtcttagtaaaagaattccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacttacttcagtgcagtgaaacttcgttggctccttgacaat
gtgagaaaagttcaaaaggccgttgaagaaaaacgagctctttttgggactattgattca
tggcttatttggagtttgacaggaggagtcaatggaggtgtccactgtacagatgtaaca
aatgcaagtaggactatgcttttcaacattcattctttggaatgggataaacaactctgc
gaattttttggaattccaatggaaattcttccaaatgtccggagttcttctgagatctat
ggcctaatgaaagctggggccttggaaggtgtgccaatatctgggtgtttaggggaccag
tctgctgcattggtgggacaaatgtgcttccagattggacaagccaaaaatacgtatgga
acaggatgtttcttactatgtaatacaggccataagtgtgtattttctgatcatggcctt
ctcaccacagtggcttacaaacttggcagagacaaaccagtatattatgctttggaaggt
tctgtagctatagctggtgctgttattcgctggctaagagacaatcttggaattataaag
acctcagaagaaattgaaaaacttgctaaagaagtaggtacttcttatggctgctacttc
gtcccagcattttcggggttatatgcaccttattgggagcccagcgcaagagggataatc
tgtggactcactcagttcaccaataaatgccatattgcttttgctgcattagaagctgtt
tgtttccaaactcgagagattttggatgccatgaatcgagactgtggaattccactcagt
catttgcaggtagatggaggaatgaccagcaacaaaattcttatgcagctacaagcagac
attctgtatataccagtagtgaagccctcaatgcccgaaaccactgcactgggtgcggct
atggcggcaggggctgcagaaggagtcggcgtatggagtctcgaacccgaggatttgtct
gccgtcacgatggagcggtttgaacctcagattaatgcggaggaaagtgaaattcgttat
tctacatggaagaaagctgtgatgaagtcaatgggttgggttacaactcaatctccagaa
agtggtattccataa

DBGET integrated database retrieval system