KEGG   Homo sapiens (human): 27101Help
Entry
27101             CDS       T01001                                 

Gene name
CACYBP, GIG5, S100A6BP, SIP
Definition
calcyclin binding protein
Orthology
K04507  
calcyclin binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    27101 (CACYBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q24-q25
AA seq 185 aa AA seqDB search
MQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTEN
VQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKVENTRW
DYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAK
GDTEF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagaaatcacagaagaaagcagaacttcttgataatgaaaaaccagctgctgtg
gttgctcccattacaacgggctatacggtgaaaatcagtaattatggatgggatcagtca
gataagtttgtgaaaatctacattaccttaactggagttcatcaagttcccactgagaat
gtgcaggtgcatttcacagagaggtcatttgatcttttggtaaagaatctaaatgggaag
agttactccatgattgtgaacaatctcttgaaacccatctctgtggaaggcagttcaaaa
aaagtcaagactgatacagttcttatattgtgtagaaagaaagtggaaaacacaaggtgg
gattacctgacccaggttgaaaaggagtgcaaagaaaaagagaagccctcctatgacact
gaaacagatcctagtgagggattgatgaatgttctaaagaaaatttatgaagatggagac
gatgatatgaagcgaaccattaataaagcctgggtggaatcaagagagaagcaagccaaa
ggagacacggaattttga

DBGET integrated database retrieval system