KEGG   Homo sapiens (human): 27101Help
Entry
27101             CDS       T01001                                 

Gene name
CACYBP, GIG5, PNAS-107, S100A6BP, SIP
Definition
(RefSeq) calcyclin binding protein
  KO
K04507  
calcyclin binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    27101 (CACYBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25.1
AA seq 228 aa AA seqDB search
MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKP
AAVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNL
NGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPS
YDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaagagctacagaaagatctagaagaggtaaaggtgttgctggaaaaggct
actaggaaaagagtacgtgatgcccttacagctgaaaaatccaagattgagacagaaatc
aagaacaagatgcaacagaaatcacagaagaaagcagaacttcttgataatgaaaaacca
gctgctgtggttgctcccattacaacgggctatacggtgaaaatcagtaattatggatgg
gatcagtcagataagtttgtgaaaatctacattaccttaactggagttcatcaagttccc
actgagaatgtgcaggtgcatttcacagagaggtcatttgatcttttggtaaagaatcta
aatgggaagagttactccatgattgtgaacaatctcttgaaacccatctctgtggaaggc
agttcaaaaaaagtcaagactgatacagttcttatattgtgtagaaagaaagtggaaaac
acaaggtgggattacctgacccaggttgaaaaggagtgcaaagaaaaagagaagccctcc
tatgacactgaaacagatcctagtgagggattgatgaatgttctaaagaaaatttatgaa
gatggagacgatgatatgaagcgaaccattaataaagcctgggtggaatcaagagagaag
caagccaaaggagacacggaattttga

DBGET integrated database retrieval system