KEGG   Homo sapiens (human): 2712Help
Entry
2712              CDS       T01001                                 

Gene name
GK2, GKP2, GKTA
Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13
AA seq 553 aa AA seqDB search
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
TTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIY
GLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSM
VMLIGARYISGVP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccaaagacagcagctgtggggccgttggtgggagcggtggtccagggcacc
aactccactcgctttctggttttcaattcaaaaacagcggaactacttagtcatcacaaa
gtggaattaacacaagagttcccaaaagaaggatgggtggaacaagaccctaaagaaatt
cttcagtctgtctacgagtgtatagcgagaacgtgtgagaaacttgacgaactgaatatt
gatatatccaacataaaagctgttggtgtcagcaatcagagggaaaccactgtaatctgg
gacaagttaacaggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
actactgttgaggatcttagtaaaaaaattccaggaaatagtaacttcgtcaagtctaag
acaggccttccactcagcacttacttcagtgcagtaaaacttcgttggatgcttgacaat
gtgagaaacgtccaaaaggctgttgaagaaggtagagctctttttggtaccattgattca
tggcttatctggagtttgacaggaggagttaatggaggcgtgcattgtacagatgtaaca
aatgcaagtaggacaatgctttttaatatccattctttggaatgggataaagagctctgt
gacttttttgaaattccaatggaccttcttccaaatgtcttcagttcttctgagatctat
ggcctaattaaaactggagccctggaaggtgtgccaatatctgggtgtttgggggaccaa
tgtgctgcattagtaggacaaatgtgcttccaggagggacaagccaaaaacacctatgga
acaggttgcttcttactgtgtaatacgggtcgtaaatgtgtgttttctgaacatggcctt
ttgaccacagtagcttacaaactaggcagagagaagccagcatattatgcactggaaggt
tctgttgctatagcaggtgctgttattcgttggctaagagacaatcttggaattatagag
acctcaggagacattgaaagacttgctaaagaagtaggaacttcttatggctgttacttt
gtcccagccttttcagggttatatgcaccttattgggagcccagtgcaagagggatactc
tgtggcctcactcagtttaccaataaatgtcatattgcttttgctgcattagaagctgtt
tgtttccaaacccgagagattttggaagccatgaaccgtgactgtggaattccacttcgt
catttgcaggtagatggaggaatgaccaacaacaaagttcttatgcagctacaagcagat
attcttcatattccagtaataaaaccctttatgcctgaaacaactgcactaggagctgcc
atggcagcaggggctgcagagggagtaagcgtttggagccttgaaccccaggctttgtca
gttctcaggatggaacgatttgaaccacagatccaggccacagaaagtgaaattcgttat
gccacatggaagaaagccgtaatgaagtcaatgggttgggttaccagtcagtctcctgaa
ggtggtgatccttctatcttctctagtctgcctttgggattttttatagtgagtagcatg
gtaatgctaattggagcaagatatatctcgggtgtgccataa

DBGET integrated database retrieval system