KEGG   Homo sapiens (human): 27121Help
Entry
27121             CDS       T01001                                 

Gene name
DKK4, DKK-4
Definition
dickkopf WNT signaling pathway inhibitor 4
Orthology
K02165  
dickkopf
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    27121 (DKK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.2-p11.1
AA seq 224 aa AA seqDB search
MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEK
PFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPV
QENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRG
HKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggccgtcctgctggggctgagctggctctgctctcccctgggagctctggtc
ctggacttcaacaacatcaggagctctgctgacctgcatggggcccggaagggctcacag
tgcctgtctgacacggactgcaataccagaaagttctgcctccagccccgcgatgagaag
ccgttctgtgctacatgtcgtgggttgcggaggaggtgccagcgagatgccatgtgctgc
cctgggacactctgtgtgaacgatgtttgtactacgatggaagatgcaaccccaatatta
gaaaggcagcttgatgagcaagatggcacacatgcagaaggaacaactgggcacccagtc
caggaaaaccaacccaaaaggaagccaagtattaagaaatcacaaggcaggaagggacaa
gagggagaaagttgtctgagaacttttgactgtggccctggactttgctgtgctcgtcat
ttttggacgaaaatttgtaagccagtccttttggagggacaggtctgctccagaagaggg
cataaagacactgctcaagctccagaaatcttccagcgttgcgactgtggccctggacta
ctgtgtcgaagccaattgaccagcaatcggcagcatgctcgattaagagtatgccaaaaa
atagaaaagctataa

DBGET integrated database retrieval system