KEGG   Homo sapiens (human): 27127Help
Entry
27127             CDS       T01001                                 

Gene name
SMC1B, SMC1BETA, SMC1L2
Definition
structural maintenance of chromosomes 1B
Orthology
K06636  
structural maintenance of chromosome 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    27127 (SMC1B)
   04114 Oocyte meiosis
    27127 (SMC1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.31
AA seq 1161 aa AA seqDB search
MAHLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKN
IQELIHGAHIGKPISSSASVKIIYVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAE
LEKIGIIVKAQNCLVFQGTVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEE
DAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKKIHLLNT
KLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIK
AKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILH
KKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGN
LKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEVNEELNLI
RSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGR
FITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKT
QFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLK
YKARCWDEKELKNLRDRRSQKIQELKGLMKTLRKETDLKQIQTLIQGTQTRLKYSQNELE
MIKKKHLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHF
CEEIGVENIREFENKHVKRQQEIDQKRLEFEKQKTRLNVQLEYSRSHLKKKLNKINTLKE
TIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLA
VDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVEMGTEAE
STQATIDIYEKEEAFEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPN
LRALENLKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQI
YKKLCRNNSAQVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIYPEYDDCMFSRVLTL
DLSQYPDTEGQESSKRHGESR
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggcccacctggagctgctgcttgtggaaaatttcaagtcgtggcggggccgccaggtc
attggccccttccggaggttcacctgcatcatcggccccaacggctctggaaaatctaat
gtaatggatgcacttagttttgtaatgggagagaaaatagctaatttaagagtgaaaaat
attcaagaactcattcatggagcacatattggaaaacctatttcttcttctgcaagtgta
aaaattatatatgtggaggaaagtggcgaagagaaaacatttgcaaggattatccgaggg
ggatgctcagaatttcgctttaatgataatcttgtgagtcgttctgtttacattgcagag
ttggaaaagataggcataatagtcaaagcacaaaattgtttggtttttcagggaactgta
gagtcaatttcagtgaagaaacccaaagaaaggacccagttttttgaggaaatcagcact
tcaggagagcttataggagaatatgaagaaaagaaaagaaagttacaaaaagccgaagag
gatgcacagtttaactttaataagaaaaaaaatatagcggcagagcgcagacaagcaaaa
ttagagaaggaagaggcagaacgttaccagagtctccttgaagaactgaaaatgaacaag
atacaactgcagctttttcaactataccataatgagaaaaagattcatctcctgaacacc
aagttagagcatgtgaatagggatttgagtgtcaaaagagagtctttgtctcatcatgaa
aacatagttaaagccaggaaaaaggaacatggaatgctaactagacaactacaacaaaca
gaaaaagaattaaaatcggttgaaacccttttaaatcagaagaggcctcagtacattaaa
gccaaagaaaacacttctcaccaccttaagaaattagatgtggctaagaaatcaataaag
gacagcgaaaaacaatgttctaaacaggaagatgatataaaagccctggagacagagctg
gctgatttagatgctgcatggagaagttttgaaaagcagattgaggaagaaattttacat
aaaaagcgagacattgaactggaagccagtcagctggatcgttataaagaacttaaggaa
caagtaagaaagaaagtagctacaatgactcaacaactggaaaaactgcagtgggaacag
aagacagatgaagaaagactggcatttgaaaagaggaggcatggagaagttcagggaaat
ctaaaacaaataaaagaacaaatagaagatcataaaaaacgaatagagaagttagaggag
tatacaaagacatgcatggattgcttgaaagagaaaaaacagcaagaggaaaccctagtg
gatgaaattgaaaaaacaaaatcaagaatgtctgaagttaatgaagaattgaatcttatt
agaagtgaattgcagaatgctgggattgatacccatgagggaaaacgtcagcaaaagaga
gcagaggttctggaacaccttaaaagactgtacccagattctgtgtttggaagactattt
gacctgtgtcatcctattcataagaaataccagctggctgttactaaggtttttggccgg
ttcatcactgccattgttgtagcctctgaaaaggtagcaaaagattgtattcgatttctg
aaggaggaaagagctgaacctgagacattcctcgctctagattaccttgatatcaagcca
atcaatgaaagactaagggagcttaaaggctgtaaaatggtgattgatgtcataaagact
cagtttcctcagctgaagaaagtgattcagtttgtgtgtggaaatggtcttgtttgtgag
actatggaagaagcaaggcatattgcactcagtggacctgaaagacagaaaacagtagct
cttgatggaacattatttttaaaatctggagtgatctctggagggtcaagtgacttaaaa
tacaaggctagatgctgggatgagaaagagttaaagaatctaagagacagacgaagccag
aaaatccaagagctaaagggtttaatgaagacactccgcaaagaaacagatttgaaacaa
atacagaccctgatacagggaactcaaacacgactcaaatattcacaaaatgaactagag
atgattaagaagaagcaccttgttgctttttaccaggaacaatctcagttacaaagtgaa
ctactaaatattgagtctcaatgtattatgttgagtgaaggaatcaaggaacgacaacga
agaattaaagaatttcaagaaaagatagataaggtagaagacgatatcttccaacacttc
tgtgaagaaattggcgtggaaaatattcgtgaatttgagaacaaacatgttaaacggcaa
caagaaattgatcaaaaaagattagaatttgaaaaacaaaaaactcggcttaatgttcaa
cttgagtatagtcgcagtcaccttaagaagaaactgaataagatcaacacattaaaagaa
actatccagaaaggtagtgaagatattgatcacctaaagaaggctgaagaaaactgtctg
cagacagtgaatgaactcatggcaaagcagcagcaacttaaggacatacgtgtcactcag
aactccagtgccgagaaagttcaaactcaaattgaagaggaacggaagaagtttctggct
gttgatagggaagtggggaaattgcaaaaagaagttgtaagtattcaaacttctctggaa
cagaaacgattagagaagcataacttgctgcttgattgcaaagtgcaagacattgagata
atccttttgtcggggtcactggatgacatcattgaagtggagatgggaactgaagcagaa
agtacccaggcaacaattgatatctatgaaaaagaagaagcctttgaaatagactacagc
tctctaaaagaggatttgaaggctctacagtctgatcaagaaatcgaggcccaccttagg
ctcttattgcagcaagtagcatcccaggaagatatcttactgaaaacagcagccccaaac
ctacgagcactggagaacttaaagactgtcagagacaagtttcaagagtccacagatgct
tttgaggccagcagaaaggaagccagactgtgtaggcaagagttcgagcaagtgaaaaaa
aggagatacgatcttttcacccagtgttttgagcatgtctcaatctcaattgatcaaatc
tacaagaagctctgcagaaacaacagcgcccaagtgtcaagttacatcaaagagcaaact
caagaccagtttcagatgatagtcatctccctaaaagaagagttctattccagagccgac
gcgctgatcggcatctatcctgagtacgatgactgcatgttcagccgagttttgacccta
gatctttctcagtatccagacactgaaggccaagaaagcagcaagagacacggagagtcc
cgctag

DBGET integrated database retrieval system