KEGG   Homo sapiens (human): 27133Help
Entry
27133             CDS       T01001                                 

Gene name
KCNH5, EAG2, H-EAG2, Kv10.2, hEAG2
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 5
  KO
K04908  
potassium voltage-gated channel Eag-related subfamily H member 5
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   27133 (KCNH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
14q23.2
AA seq 988 aa AA seqDB search
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
DEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSF
SRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTLSIPVDHPVRKLFQKFKQQKELR
NQGSTQGDPERNQLQVESRSLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRD
AMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLL
SEDPKSSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPIQADAKHPFYP
IPEQALQTTLQEVKHELKEDIQLLSCRMTALEKQVAEILKILSEKSVPQASSPKSQMPLQ
VPPQIPCQDIFSVSRPESPESDKDEIHF
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgccggggggcaagagagggctggtggcaccgcagaacacatttttggagaacatcgtc
aggcgctccagtgaatcaagtttcttactgggaaatgcccagattgtggattggcctgta
gtttatagtaatgacggtttttgtaaactctctggatatcatcgagctgacgtcatgcag
aaaagcagcacttgcagttttatgtatggggaattgactgacaagaagaccattgagaaa
gtcaggcaaacttttgacaactacgaatcaaactgctttgaagttcttctgtacaagaaa
aacagaacccctgtttggttttatatgcaaattgcaccaataagaaatgaacatgaaaag
gtggtcttgttcctgtgtactttcaaggatattacgttgttcaaacagccaatagaggat
gattcaacaaaaggttggacgaaatttgcccgattgacacgggctttgacaaatagccga
agtgttttgcagcagctcacgccaatgaataaaacagaggtggtccataaacattcaaga
ctagctgaagttcttcagctgggatcagatatccttcctcagtataaacaagaagcgcca
aagacgccaccacacattattttacattattgtgcttttaaaactacttgggattgggtg
attttaattcttaccttctacaccgccattatggttccttataatgtttccttcaaaaca
aagcagaacaacatagcctggctggtactggatagtgtggtggacgttatttttctggtt
gacatcgttttaaattttcacacgactttcgtggggcccggtggagaggtcatttctgac
cctaagctcataaggatgaactatctgaaaacttggtttgtgatcgatctgctgtcttgt
ttaccttatgacatcatcaatgcctttgaaaatgtggatgagggaatcagcagtctcttc
agttctttaaaagtggtgcgtctcttacgactgggccgtgtggctaggaaactggaccat
tacctagaatatggagcagcagtcctcgtgctcctggtgtgtgtgtttggactggtggcc
cactggctggcctgcatatggtatagcatcggagactacgaggtcattgatgaagtcact
aacaccatccaaatagacagttggctctaccagctggctttgagcattgggactccatat
cgctacaataccagtgctgggatatgggaaggaggacccagcaaggattcattgtacgtg
tcctctctctactttaccatgacaagccttacaaccataggatttggaaacatagctcct
accacagatgtggagaagatgttttcggtggctatgatgatggttggctctcttctttat
gcaactatttttggaaatgttacaacaattttccagcaaatgtatgccaacaccaaccga
taccatgagatgctgaataatgtacgggacttcctaaaactctatcaggtcccaaaaggc
cttagtgagcgagtcatggattatattgtctcaacatggtccatgtcaaaaggcattgat
acagaaaaggtcctctccatctgtcccaaggacatgagagctgatatctgtgttcatcta
aaccggaaggtttttaatgaacatcctgcttttcgattggccagcgatgggtgtctgcgc
gccttggcggtagagttccaaaccattcactgtgctcccggggacctcatttaccatgct
ggagaaagtgtggatgccctctgctttgtggtgtcaggatccttggaagtcatccaggat
gatgaggtggtggctattttagggaagggtgatgtatttggagacatcttctggaaggaa
accacccttgcccatgcatgtgcgaacgtccgggcactgacgtactgtgacctacacatc
atcaagcgggaagccttgctcaaagtcctggacttttatacagcttttgcaaactccttc
tcaaggaatctcactcttacttgcaatctgaggaaacggatcatctttcgtaagatcagt
gatgtgaagaaagaggaggaggagcgcctccggcagaagaatgaggtgaccctcagcatt
cccgtggaccacccagtcagaaagctcttccagaagttcaagcagcagaaggagctgcgg
aatcagggctcaacacagggtgaccctgagaggaaccaactccaggtagagagccgctcc
ttacagaatggagcctccatcaccggaaccagcgtggtgactgtgtcacagattactccc
attcagacgtctctggcctatgtgaaaaccagtgaatcccttaagcagaacaaccgtgat
gccatggaactcaagcccaacggcggtgctgaccaaaaatgtctcaaagtcaacagccca
ataagaatgaagaatggaaatggaaaagggtggctgcgactcaagaataatatgggagcc
catgaggagaaaaaggaagactggaataatgtcactaaagctgagtcaatggggctattg
tctgaggaccccaagagcagtgattcagagaacagtgtgaccaaaaacccactaagaaaa
acagattcttgtgacagtggaattacaaaaagtgaccttcgtttggataaggctggggag
gcccgaagtccgctagagcacagtcccatccaggctgatgccaagcaccccttttatccc
atccccgagcaggccttacagaccacactgcaggaagtcaaacacgaactcaaagaggac
atccagctgctcagctgcagaatgactgccctagaaaagcaggtggcagaaattttaaaa
atactgtcggaaaaaagcgtaccccaggcctcatctcccaaatcccaaatgccactccaa
gtacccccccagataccatgtcaggatatttttagtgtctcaaggcctgaatcacctgaa
tctgacaaagatgaaatccacttttaa

DBGET integrated database retrieval system