KEGG   Homo sapiens (human): 27134Help
Entry
27134             CDS       T01001                                 

Gene name
TJP3, ZO-3, ZO3
Definition
(RefSeq) tight junction protein 3
  KO
K06097  
tight junction protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    27134 (TJP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95049(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 919 aa AA seqDB search
MEELTIWEQHTATLSKDPRRGFGIAISGGRDRPGGSMVVSDVVPGGPAEGRLQTGDHIVM
VNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQR
VEEVDQGRGYDGDSSSGSGRSWDERSRRPRPGRRGRAGSHGRRSPGGGSEANGLALVSGF
KRLPRQDVQMKPVKSVLVKRRDSEEFGVKLGSQIFIKHITDSGLAARHRGLQEGDLILQI
NGVSSQNLSLNDTRRLIEKSEGKLSLLVLRDRGQFLVNIPPAVSDSDSSPLEDISDLASE
LSQAPPSHIPPPPRHAQRSPEASQTDSPVESPRLRRESSVDSRTISEPDEQRSELPRESS
YDIYRVPSSQSMEDRGYSPDTRVVRFLKGKSIGLRLAGGNDVGIFVSGVQAGSPADGQGI
QEGDQILQVNDVPFQNLTREEAVQFLLGLPPGEEMELVTQRKQDIFWKMVQSRVGDSFYI
RTHFELEPSPPSGLGFTRGDVFHVLDTLHPGPGQSHARGGHWLAVRMGRDLREQERGIIP
NQSRAEQLASLEAAQRAVGVGPGSSAGSNARAEFWRLRGLRRGAKKTTQRSREDLSALTR
QGRYPPYERVVLREASFKRPVVILGPVADIAMQKLTAEMPDQFEIAETVSRTDSPSKIIK
LDTVRVIAEKDKHALLDVTPSAIERLNYVQYYPIVVFFIPESRPALKALRQWLAPASRRS
TRRLYAQAQKLRKHSSHLFTATIPLNGTSDTWYQELKAIIREQQTRPIWTAEDQLDGSLE
DNLDLPHHGLADSSADLSCDSRVNSDYETDGEGGAYTDGEGYTDGEGGPYTDVDDEPPAP
ALARSSEPVQADESQSPRDRGRISAHQGAQVDSRHPQGQWRQDSMRTYEREALKKKFMRV
HDAESSDEDGYDWGPATDL
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctgaccatctgggaacagcacacggccacactgtccaaggacccccgccgg
ggctttggcattgcgatctctggaggccgagaccggcccggtggatccatggttgtatct
gacgtggtacctggagggccggcggagggcaggctacagacaggcgaccacatcgtcatg
gtgaacggggtttccatggagaatgccacctccgcgtttgccattcagatactcaagacc
tgcaccaagatggccaacatcacagtgaaacgtccccggaggatccacctgcccgccacc
aaagccagcccctccagcccagggcgccaggactcggatgaagacgatgggccccagcgg
gtggaggaggtggaccagggccggggctatgacggcgactcatccagtggctccggccgc
tcctgggacgagcgctcccgccggccgaggcctggtcgccggggccgggccggcagccat
gggcgtaggagcccaggtggtggctctgaggccaacgggctggccctggtgtccggcttt
aagcggctgccacggcaggacgtgcagatgaagcctgtgaagtcagtgctggtgaagagg
agagacagcgaagagtttggcgtcaagctgggcagtcagatcttcatcaagcacattaca
gattcgggcctggctgcccggcaccgtgggctgcaggaaggagatctcattctacagatc
aacggggtgtctagccagaacctgtcactgaacgacacccggcgactgattgagaagtca
gaagggaagctaagcctgctggtgctgagagatcgtgggcagttcctggtgaacattccg
cctgctgtcagtgacagcgacagctcgccattggaggacatctcggacctcgcctcggag
ctatcgcaggcaccaccatcccacatcccaccaccaccccggcatgctcagcggagcccc
gaggccagccagaccgactctcccgtggagagtccccggcttcggcgggaaagttcagta
gattccagaaccatctcggaaccagatgagcaacggtcagagttgcccagggaaagcagc
tatgacatctacagagtgcccagcagtcagagcatggaggatcgtgggtacagccccgac
acgcgtgtggtccgcttcctcaagggcaagagcatcgggctgcggctggcagggggcaat
gacgtgggcatcttcgtgtccggggtgcaggcgggcagcccggccgacgggcagggcatc
caggagggagatcagattctgcaggtgaatgacgtgccattccagaacctgacacgggag
gaggcagtgcagttcctgctggggctgccaccaggcgaggagatggagctggtgacgcag
aggaagcaggacattttctggaaaatggtgcagtcccgcgtgggtgactccttctacatc
cgcactcactttgagctggagcccagtccaccgtctggcctgggcttcacccgtggcgac
gtcttccacgtgctggacacgctgcaccccggccccgggcagagccacgcacgaggaggc
cactggctggcggtgcgcatgggtcgtgacctgcgggagcaagagcggggcatcattccc
aaccagagcagggcggagcagctggccagcctggaagctgcccagagggccgtgggagtc
gggcccggctcctccgcgggctccaatgctcgggccgagttctggcggctgcggggtctt
cgtcgaggagccaagaagaccactcagcggagccgtgaggacctctcagctctgacccga
cagggccgctacccgccctacgaacgagtggtgttgcgagaagccagtttcaagcgcccg
gtagtgatcctgggacccgtggccgacattgctatgcagaagttgactgctgagatgcct
gaccagtttgaaatcgcagagactgtgtccaggaccgacagcccctccaagatcatcaaa
ctagacaccgtgcgggtgattgcagaaaaagacaagcatgcgctcctggatgtgaccccc
tccgccatcgagcgcctcaactatgtgcagtactaccccattgtggtcttcttcatcccc
gagagccggccggccctcaaggcactgcgccagtggctggcgcctgcctcccgccgcagc
acccgtcgcctctacgcacaagcccagaagctgcgaaaacacagcagccacctcttcaca
gccaccatccctctgaatggcacgagtgacacctggtaccaggagctcaaggccatcatt
cgagagcagcagacgcggcccatctggacggcggaagatcagctggatggctccttggag
gacaacctagacctccctcaccacggcctggccgacagctccgctgacctcagctgcgac
agccgcgttaacagcgactacgagacggacggcgagggcggcgcgtacacggatggcgag
ggctacacagacggcgagggggggccctacacggatgtggatgatgagcccccggctcca
gccctggcccggtcctcggagcccgtgcaggcagatgagtcccagagcccgagggatcgt
gggagaatctcggctcatcagggggcccaggtggacagccgccacccccagggacagtgg
cgacaggacagcatgcgaacctatgaacgggaagccctgaagaaaaagtttatgcgagta
catgatgcggagtcctccgatgaagacggctatgactggggtccggccactgacctgtga

DBGET integrated database retrieval system