KEGG   Homo sapiens (human): 27148Help
Entry
27148             CDS       T01001                                 

Gene name
STK36, FU
Definition
(RefSeq) serine/threonine kinase 36 (EC:2.7.11.1)
  KO
K06228  
fused [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Basal cell carcinoma
Module
Hedgehog signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    27148 (STK36)
   05217 Basal cell carcinoma
    27148 (STK36)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27148 (STK36)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  ULK family [OT]
   27148 (STK36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 1315 aa AA seqDB search
MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRH
PNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHR
ILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHT
ADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKNFLQGLLTKDPR
QRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR
ILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILAS
ELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEW
QHLLETTEPVPIQLKAPLTLLCNPDFCQRIQSQLHEAGGQILKGILEGASHILPAFRVLS
SLLSSCSDSVALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFA
CTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGN
SRAISKAFYSSLLTTQQVVLDGLLHGLTVPQLPVHTPQGAPQVSQPLREQSEDIPGAISS
ALAAICTAPVGLPDCWDAKEQVCWHLANQLTEDSSQLRPSLISGLQHPILCLHLLKVLYS
CCLVSEGLCRLLGQEPLALESLFMLIQGKVKVVDWEESTEVTLYFLSLLVFRLQNLPCGM
EKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWMAAATHALSAPAEVRL
TPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEG
ELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLC
PSFLNQLRQAPHGSEFLPVVVLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQV
CCYHLPLMQVELPISLLTRLALMDPTSLNQFVNTVSASPRTIVSFLSVALLSDQPLLTSD
LLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSVRAHTYRLLGHLLQHS
MALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPALAAAVPSMTQL
LGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSL
QQEPGIHQVLVSLGASEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtaccacgtgttggagatgattggagaaggctcttttgggagggtgtacaag
ggtcgaagaaaatacagtgctcaggtcgtggccctgaagttcatcccaaaattggggcgc
tcagagaaggagctgaggaatttgcaacgagagattgaaataatgcggggtctgcggcat
cccaacattgtgcatatgcttgacagctttgaaactgataaagaggtggtggtggtgaca
gactatgctgagggagagctctttcagatcctagaagatgacggaaaacttcctgaagac
caggttcaggccattgctgcccagttggtgtcagccctgtactatctgcattcccaccgc
atcctacaccgagatatgaagcctcagaacatcctcctcgccaagggtggtggcatcaag
ctctgtgactttggatttgcccgggctatgagcaccaatacaatggtgctgacatccatc
aaaggcacaccactctatatgtctccagagctggtggaggagcgaccatacgaccacaca
gcggacctctggtctgttggctgcatactatatgaactggcagtaggcacccctcccttc
tatgctacaagcatctttcagctggtcagcctcattctcaaggaccctgtgcgctggccc
tcaaccatcagtccctgctttaagaacttcctgcagggactgctcaccaaagacccacgg
cagcgactgtcctggccagacctcttatatcacccctttattgctggtcatgtcaccata
ataactgagccagcaggcccagatttggggaccccattcaccagccgcctacccccagaa
cttcaggtcctaaaggacgaacaggcccatcggttggcccccaagggtaatcagtctcgc
atcttgactcaggcctataaacgcatggctgaggaggccatgcagaagaaacatcagaac
acaggacctgcccttgagcaagaggacaagaccagcaaggtggctcctggcacagcccct
ctgcccagactcggggccactcctcaggaatcaagcctcctggccgggatcttagcctca
gaattgaagagcagctgggctaaatcagggactggagaggtgccctctgcacctcgggaa
aaccggaccaccccagattgtgaacgagcattcccagaggagaggccagaggtgctgggc
cagcggagcactgatgtagtggacctggaaaatgaggagccagacagtgacaatgagtgg
cagcacctgctagagaccactgagcctgtgcctattcaactgaaggctcctctcaccttg
ctgtgtaatcctgacttctgccagcgcatccagagtcagctgcatgaagctggagggcag
atcctgaaaggcatcttggagggtgcttcccacatcctgcctgcattccgggtcctgagc
agtcttctctccagctgcagtgattctgttgccttgtattccttctgccgggaggcaggg
cttcctgggctgctgctgagtctactcaggcacagtcaggagagcaacagcctccagcag
caatcttggtatgggaccttcttacaggacctgatggctgtgattcaggcctactttgcc
tgtaccttcaatctggagaggagccagacaagtgacagcctgcaggtgtttcaggaggct
gccaacctttttctggacctgttggggaaactgctggcccaaccagatgactctgagcag
actttgcggagggacagccttatgtgctttactgtcctgtgcgaagccatggatgggaac
agccgggccatctccaaagccttttactccagcttgctgacgacacagcaggttgtcttg
gatgggctccttcatggcttgacagttccacagctccctgtccacactccccaaggagcc
ccgcaagtgagccagccactgcgagagcagagtgaggatatacctggagccatttcctct
gccctggcagccatatgcactgctcctgtgggactgcccgactgctgggatgccaaggag
caggtctgttggcatttggcaaatcagctaactgaagacagcagccagctcaggccatcc
ctcatctctggcctgcagcatcccatcctgtgcctgcaccttctcaaggttctatactcc
tgctgccttgtcagtgagggcctgtgccgtcttctggggcaggagcccctggccttggaa
tccctgtttatgttgattcagggcaaggtaaaagtagtagattgggaagagtctactgaa
gtgacactctacttcctctcccttcttgtctttcggctccaaaacctgccttgtggaatg
gagaagctaggcagtgacgttgctactctctttacccattcgcatgtcgtctctcttgtg
agtgcagcagcctgtctattgggacagcttggtcagcaaggggtgacctttgacctccag
cccatggaatggatggctgcagccacacatgccttgtctgcccctgcagaggttcggttg
actccaccaggtagttgtggattctatgatggcctccttatccttctgttgcagctcctc
actgagcaggggaaggctagcctaatcagggatatgtccagttcagaaatgtggaccgtt
ttgtggcaccgcttctccatggtcctgaggctccccgaggaggcatctgcacaggaaggg
gagctttcgctatccagtccaccaagccctgagccagactggacactgatttctccccag
ggcatggcagccctgctgagcctggccatggccacctttacccaggagccccagttatgc
ctgagctgcctgtcccagcatggaagtatcctcatgtccatcctgaagcatctgctttgc
cccagcttcctgaatcaactgcgccaggcgcctcatgggtctgagtttctccctgtcgtg
gtgctctctgtctgccagctcctttgcttcccctttgcgctggacatggatgctgacctc
cttataggtgtcttggccgacctcagggactcagaagttgcagcccatctgctgcaggtc
tgctgctaccatcttccgttgatgcaagtggagctgcccatcagccttctcacacgcctg
gccctcatggatcccacctctctcaaccagtttgtgaacacagtgtctgcctcccctaga
accatcgtctcgtttctctcagttgccctcctgagtgaccagccactgttgacctccgac
cttctctctctgctggcccatactgccagggtcctgtctcccagccacttgtcctttatc
caagagcttctggctggctctgatgaatcctatcggcccctgcgcagcctcctgggccac
ccagagaattctgtgcgggcacacacttataggctcctgggacacttgctccaacacagc
atggccctgcgtggggcactgcagagccagtctggactgctcagccttctgctgcttggg
cttggagacaaggatcctgttgtgcggtgcagtgccagctttgctgtgggcaatgcagcc
taccaggctggtcctctgggacctgccctggcagctgcagtgcccagtatgacccagctg
cttggagatcctcaggctggtatccggcgcaatgttgcatcagctctgggcaacttggga
cctgaaggtttgggagaggagctgttacagtgcgaagtaccccagcggctcctagaaatg
gcatgtggagacccccagccaaatgtgaaggaggctgccctcattgccctccggagcctg
caacaggagcctggcatccatcaggtactggtgtccctgggtgccagtgagaaactatcc
ttgctctctctggggaatcagtcactgccacacagcagtcctaggcctgcctctgccaaa
cactgcaggaaactcattcacctcctgaggccagcccatagcatgtga

DBGET integrated database retrieval system