KEGG   Homo sapiens (human): 27159Help
Entry
27159             CDS       T01001                                 

Gene name
CHIA, AMCASE, CHIT2, TSA1902
Definition
chitinase, acidic (EC:3.2.1.14)
Orthology
K01183  
chitinase [EC:3.2.1.14]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.2
AA seq 315 aa AA seqDB search
MREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGY
TGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGI
GAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKS
FDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPI
EPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQ
AGLVFDTSCDCCNWA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagcttttgagcaggaggccaagcagatcaacaagcccaggctgatggtcact
gctgcagtagctgctggcatctccaatatccagtctggctatgagatcccccaactgtca
cagtacctggactacatccatgtcatgacctacgacctccatggctcctgggagggctac
actggagagaacagccccctctacaaatacccgactgacaccggcagcaacgcctacctc
aatgtggattatgtcatgaactactggaaggacaatggagcaccagctgagaagctcatc
gttggattccctacctatggacacaacttcatcctgagcaacccctccaacactggaatt
ggtgcccccacctctggtgctggtcctgctgggccctatgccaaggagtctgggatctgg
gcttactacgagatctgtaccttcctgaaaaatggagccactcagggatgggatgcccct
caggaagtgccttatgcctatcagggcaatgtgtgggttggctatgacaacatcaagagc
ttcgatattaaggctcaatggcttaagcacaacaaatttggaggcgccatggtctgggcc
attgatctggatgacttcactggcactttctgcaaccagggcaagtttcccctaatctcc
accctgaagaaggccctcggcctgcagagtgcaagttgcacggctccagctcagcccatt
gagccaataactgctgctcccagtggcagcgggaacgggagcgggagtagcagctctgga
ggcagctcgggaggcagtggattctgtgctgtcagagccaacggcctctaccccgtggca
aataacagaaatgccttctggcactgcgtgaatggagtcacgtaccagcagaactgccag
gccgggcttgtcttcgacaccagctgtgattgctgcaactgggcataa

DBGET integrated database retrieval system