KEGG   Homo sapiens (human): 27161Help
Entry
27161             CDS       T01001                                 

Gene name
AGO2, CASC7, EIF2C2, LINC00980, PPD, Q10
Definition
(RefSeq) argonaute 2, RISC catalytic component
  KO
K11593  
eukaryotic translation initiation factor 2C
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     27161 (AGO2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    27161 (AGO2)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     27161 (AGO2)
   microRNA pathway
    RISC loading complex
     27161 (AGO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UKV8(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 859 aa AA seqDB search
MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELD
IKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLP
GEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRS
FFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDF
KSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQES
GQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ
TSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY
GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD
AGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVL
GMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTH
PPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFK
PTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDK
NERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQ
ILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ
ALAKAVQVHQDTLRTMYFA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtactcgggagccggccccgcacttgcacctcctgcgccgccgccccccatccaagga
tatgccttcaagcctccacctagacccgactttgggacctccgggagaacaatcaaatta
caggccaatttcttcgaaatggacatccccaaaattgacatctatcattatgaattggat
atcaagccagagaagtgcccgaggagagttaacagggaaatcgtggaacacatggtccag
cactttaaaacacagatctttggggatcggaagcccgtgtttgacggcaggaagaatcta
tacacagccatgccccttccgattgggagggacaaggtggagctggaggtcacgctgcca
ggagaaggcaaggatcgcatcttcaaggtgtccatcaagtgggtgtcctgcgtgagcttg
caggcgttacacgatgcactttcagggcggctgcccagcgtcccttttgagacgatccag
gccctggacgtggtcatgaggcacttgccatccatgaggtacacccccgtgggccgctcc
ttcttcaccgcgtccgaaggctgctctaaccctcttggcgggggccgagaagtgtggttt
ggcttccatcagtccgtccggccttctctctggaaaatgatgctgaatattgatgtgtca
gcaacagcgttttacaaggcacagccagtaatcgagtttgtttgtgaagttttggatttt
aaaagtattgaagaacaacaaaaacctctgacagattcccaaagggtaaagtttaccaaa
gaaattaaaggtctaaaggtggagataacgcactgtgggcagatgaagaggaagtaccgc
gtctgcaatgtgacccggcggcccgccagtcaccaaacattcccgctgcagcaggagagc
gggcagacggtggagtgcacggtggcccagtatttcaaggacaggcacaagttggttctg
cgctacccccacctcccatgtttacaagtcggacaggagcagaaacacacctaccttccc
ctggaggtctgtaacattgtggcaggacaaagatgtattaaaaaattaacggacaatcag
acctcaaccatgatcagagcgactgctaggtcggcgcccgatcggcaagaagagattagc
aaattgatgcgaagtgcaagtttcaacacagatccatacgtccgtgaatttggaatcatg
gtcaaagatgagatgacagacgtgactgggcgggtgctgcagccgccctccatcctctac
gggggcaggaataaagctattgcgacccctgtccagggcgtctgggacatgcggaacaag
cagttccacacgggcatcgagatcaaggtgtgggccattgcgtgcttcgccccccagcgc
cagtgcacggaagtccatctgaagtccttcacagagcagctcagaaagatctcgagagac
gccggcatgcccatccagggccagccgtgcttctgcaaatacgcgcagggggcggacagc
gtggagcccatgttccggcacctgaagaacacgtatgcgggcctgcagctggtggtggtc
atcctgcccggcaagacgcccgtgtacgccgaggtcaagcgcgtgggagacacggtgctg
gggatggccacgcagtgcgtgcagatgaagaacgtgcagaggaccacgccacagaccctg
tccaacctctgcctgaagatcaacgtcaagctgggaggcgtgaacaacatcctgctgccc
cagggcaggccgccggtgttccagcagcccgtcatctttctgggagcagacgtcactcac
ccccccgccggggatgggaagaagccctccattgccgccgtggtgggcagcatggacgcc
caccccaatcgctactgcgccaccgtgcgcgtgcagcagcaccggcaggagatcatacaa
gacctggccgccatggtccgcgagctcctcatccagttctacaagtccacgcgcttcaag
cccacccgcatcatcttctaccgcgacggtgtctctgaaggccagttccagcaggttctc
caccacgagttgctggccatccgtgaggcctgtatcaagctagaaaaagactaccagccc
gggatcaccttcatcgtggtgcagaagaggcaccacacccggctcttctgcactgacaag
aacgagcgggttgggaaaagtggaaacattccagcaggcacgactgtggacacgaaaatc
acccaccccaccgagttcgacttctacctgtgtagtcacgctggcatccaggggacaagc
aggccttcgcactatcacgtcctctgggacgacaatcgtttctcctctgatgagctgcag
atcctaacctaccagctgtgtcacacctacgtgcgctgcacacgctccgtgtccatccca
gcgccagcatactacgctcacctggtggccttccgggccaggtaccacctggtggataag
gaacatgacagtgctgaaggaagccatacctctgggcagagtaacgggcgagaccaccaa
gcactggccaaggcggtccaggttcaccaagacactctgcgcaccatgtactttgcttga

DBGET integrated database retrieval system