KEGG   Homo sapiens (human): 27161Help
Entry
27161             CDS       T01001                                 

Gene name
AGO2, EIF2C2, Q10
Definition
(RefSeq) argonaute 2, RISC catalytic component (EC:3.1.26.n2)
  KO
K11593  
eukaryotic translation initiation factor 2C
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     27161 (AGO2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    27161 (AGO2)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     27161 (AGO2)
   microRNA pathway
    RISC loading complex
     27161 (AGO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24
AA seq 859 aa AA seqDB search
MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELD
IKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLP
GEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRS
FFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDF
KSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQES
GQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ
TSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY
GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD
AGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVL
GMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTH
PPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFK
PTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDK
NERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQ
ILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ
ALAKAVQVHQDTLRTMYFA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtactcgggagccggccccgcacttgcacctcctgcgccgccgccccccatccaagga
tatgccttcaagcctccacctagacccgactttgggacctccgggagaacaatcaaatta
caggccaatttcttcgaaatggacatccccaaaattgacatctatcattatgaattggat
atcaagccagagaagtgcccgaggagagttaacagggaaatcgtggaacacatggtccag
cactttaaaacacagatctttggggatcggaagcccgtgtttgacggcaggaagaatcta
tacacagccatgccccttccgattgggagggacaaggtggagctggaggtcacgctgcca
ggagaaggcaaggatcgcatcttcaaggtgtccatcaagtgggtgtcctgcgtgagcttg
caggcgttacacgatgcactttcagggcggctgcccagcgtcccttttgagacgatccag
gccctggacgtggtcatgaggcacttgccatccatgaggtacacccccgtgggccgctcc
ttcttcaccgcgtccgaaggctgctctaaccctcttggcgggggccgagaagtgtggttt
ggcttccatcagtccgtccggccttctctctggaaaatgatgctgaatattgatgtgtca
gcaacagcgttttacaaggcacagccagtaatcgagtttgtttgtgaagttttggatttt
aaaagtattgaagaacaacaaaaacctctgacagattcccaaagggtaaagtttaccaaa
gaaattaaaggtctaaaggtggagataacgcactgtgggcagatgaagaggaagtaccgc
gtctgcaatgtgacccggcggcccgccagtcaccaaacattcccgctgcagcaggagagc
gggcagacggtggagtgcacggtggcccagtatttcaaggacaggcacaagttggttctg
cgctacccccacctcccatgtttacaagtcggacaggagcagaaacacacctaccttccc
ctggaggtctgtaacattgtggcaggacaaagatgtattaaaaaattaacggacaatcag
acctcaaccatgatcagagcgactgctaggtcggcgcccgatcggcaagaagagattagc
aaattgatgcgaagtgcaagtttcaacacagatccatacgtccgtgaatttggaatcatg
gtcaaagatgagatgacagacgtgactgggcgggtgctgcagccgccctccatcctctac
gggggcaggaataaagctattgcgacccctgtccagggcgtctgggacatgcggaacaag
cagttccacacgggcatcgagatcaaggtgtgggccattgcgtgcttcgccccccagcgc
cagtgcacggaagtccatctgaagtccttcacagagcagctcagaaagatctcgagagac
gccggcatgcccatccagggccagccgtgcttctgcaaatacgcgcagggggcggacagc
gtggagcccatgttccggcacctgaagaacacgtatgcgggcctgcagctggtggtggtc
atcctgcccggcaagacgcccgtgtacgccgaggtcaagcgcgtgggagacacggtgctg
gggatggccacgcagtgcgtgcagatgaagaacgtgcagaggaccacgccacagaccctg
tccaacctctgcctgaagatcaacgtcaagctgggaggcgtgaacaacatcctgctgccc
cagggcaggccgccggtgttccagcagcccgtcatctttctgggagcagacgtcactcac
ccccccgccggggatgggaagaagccctccattgccgccgtggtgggcagcatggacgcc
caccccaatcgctactgcgccaccgtgcgcgtgcagcagcaccggcaggagatcatacaa
gacctggccgccatggtccgcgagctcctcatccagttctacaagtccacgcgcttcaag
cccacccgcatcatcttctaccgcgacggtgtctctgaaggccagttccagcaggttctc
caccacgagttgctggccatccgtgaggcctgtatcaagctagaaaaagactaccagccc
gggatcaccttcatcgtggtgcagaagaggcaccacacccggctcttctgcactgacaag
aacgagcgggttgggaaaagtggaaacattccagcaggcacgactgtggacacgaaaatc
acccaccccaccgagttcgacttctacctgtgtagtcacgctggcatccaggggacaagc
aggccttcgcactatcacgtcctctgggacgacaatcgtttctcctctgatgagctgcag
atcctaacctaccagctgtgtcacacctacgtgcgctgcacacgctccgtgtccatccca
gcgccagcatactacgctcacctggtggccttccgggccaggtaccacctggtggataag
gaacatgacagtgctgaaggaagccatacctctgggcagagtaacgggcgagaccaccaa
gcactggccaaggcggtccaggttcaccaagacactctgcgcaccatgtactttgcttga

DBGET integrated database retrieval system