KEGG   Homo sapiens (human): 27165Help
Entry
27165             CDS       T01001                                 

Gene name
GLS2, GA, GLS, LGA, hLGA
Definition
(RefSeq) glutaminase 2
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    27165 (GLS2)
   00220 Arginine biosynthesis
    27165 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    27165 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    27165 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    27165 (GLS2)
   04727 GABAergic synapse
    27165 (GLS2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    27165 (GLS2)
   05206 MicroRNAs in cancer
    27165 (GLS2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     27165 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UI32(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 602 aa AA seqDB search
MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGA
EIRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgaaggctctgcagaaggccctgagccgggctggcagtcactgcgggcga
ggaggctggggtcacccgagccggagccccctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgcagggcagagagacgccacacagccaccagccgcagcaccaggat
catgattcatcagaaagtggcatgctgtcccgcctgggtgatttgctcttttacactatt
gctgaaggacaggaacgaatccctatccacaagttcaccactgcactaaaggccactgga
ctgcagacatcagatcctcggctccgagactgcatgagcgagatgcaccgcgtggtccaa
gagtccagtagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgggccatgtggatcgcatctttgaggatgtcaaagagctcactggaggcaaagtggca
gcctacatccctcagctggccaagtcaaacccagacctgtggggtgtctccctgtgcact
gtggatggtcaacggcactctgtgggccacacaaagatccccttctgcctgcagtcctgt
gtgaagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaag
tttgtgggcaaagagccaagtggcctgcgctacaacaagctctccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgttgtcagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttgcagtatctcaacaaaatggctggg
aatgaatacatgggtttcagcaatgccacattccagtcagagaaggaaacaggggatcgg
aattatgccatcggctattatctcaaggaaaagaagtgctttcctaagggggtggacatg
atggctgcccttgatctctacttccagctgtgttctgtggaggtcacttgtgaatcaggc
agtgtcatggcagccaccctcgccaacggtgggatctgccccatcacaggcgagagtgtg
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtatgac
ttctctggccagtttgccttccacgtgggcctgccagccaagtcagctgtatcaggagcc
atcctcctggtggtacccaatgtcatgggaatgatgtgcctgtcacccccattggacaag
ctggggaacagccatagggggaccagcttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggca
gaaattcggaacaagactgtggtcaacctgttatttgctgcctatagtggcgatgtctca
gctcttcgaaggtttgccttgtcagccatggatatggaacagaaagactatgactcgcgc
acagctctgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgatcgag
gcttgcaaagtgaatccttttgccaaggacaggtggggcaacattcccctggatgatgct
gtgcagttcaaccatctggaggtggtcaaactgcttcaagattaccaggactcctacaca
ctctctgaaactcaggctgaggcagcagctgaggccctgtccaaagagaacttagaaagc
atggtatga

DBGET integrated database retrieval system