KEGG   Homo sapiens (human): 2717Help
Entry
2717              CDS       T01001                                 

Gene name
GLA, GALA
Definition
galactosidase, alpha (EC:3.2.1.22)
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Disease
H00125  
Fabry disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    2717 (GLA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    2717 (GLA)
   00600 Sphingolipid metabolism
    2717 (GLA)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    2717 (GLA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    2717 (GLA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     2717 (GLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq22
AA seq 429 aa AA seqDB search
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaggaacccagaactacatctgggctgcgcgcttgcgcttcgcttcctggcc
ctcgtttcctgggacatccctggggctagagcactggacaatggattggcaaggacgcct
accatgggctggctgcactgggagcgcttcatgtgcaaccttgactgccaggaagagcca
gattcctgcatcagtgagaagctcttcatggagatggcagagctcatggtctcagaaggc
tggaaggatgcaggttatgagtacctctgcattgatgactgttggatggctccccaaaga
gattcagaaggcagacttcaggcagaccctcagcgctttcctcatgggattcgccagcta
gctaattatgttcacagcaaaggactgaagctagggatttatgcagatgttggaaataaa
acctgcgcaggcttccctgggagttttggatactacgacattgatgcccagacctttgct
gactggggagtagatctgctaaaatttgatggttgttactgtgacagtttggaaaatttg
gcagatggttataagcacatgtccttggccctgaataggactggcagaagcattgtgtac
tcctgtgagtggcctctttatatgtggccctttcaaaagcccaattatacagaaatccga
cagtactgcaatcactggcgaaattttgctgacattgatgattcctggaaaagtataaag
agtatcttggactggacatcttttaaccaggagagaattgttgatgttgctggaccaggg
ggttggaatgacccagatatgttagtgattggcaactttggcctcagctggaatcagcaa
gtaactcagatggccctctgggctatcatggctgctcctttattcatgtctaatgacctc
cgacacatcagccctcaagccaaagctctccttcaggataaggacgtaattgccatcaat
caggaccccttgggcaagcaagggtaccagcttagacagggagacaactttgaagtgtgg
gaacgacctctctcaggcttagcctgggctgtagctatgataaaccggcaggagattggt
ggacctcgctcttataccatcgcagttgcttccctgggtaaaggagtggcctgtaatcct
gcctgcttcatcacacagctcctccctgtgaaaaggaagctagggttctatgaatggact
tcaaggttaagaagtcacataaatcccacaggcactgttttgcttcagctagaaaataca
atgcagatgtcattaaaagacttactttaa

DBGET integrated database retrieval system