KEGG   Homo sapiens (human): 27183Help
Entry
27183             CDS       T01001                                 

Gene name
VPS4A, SKD1, SKD1A, SKD2, VPS4, VPS4-1
Definition
(RefSeq) vacuolar protein sorting 4 homolog A
  KO
K12196  
vacuolar protein-sorting-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Necroptosis
Module
ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    27183 (VPS4A)
  Cell growth and death
   04217 Necroptosis
    27183 (VPS4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    27183 (VPS4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UN37(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16q22.1
AA seq 437 aa AA seqDB search
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgtcaaccctccagaaagccattgatctggtgacgaaagccacagaggaggac
aaagccaagaactacgaggaggcgctgcggctgtaccagcatgcggtggagtacttcctc
cacgctatcaagtatgaggcccacagcgacaaggccaaggagagcattcgagccaagtgc
gtgcagtacctagaccgggccgagaagctgaaggattatttacgaagcaaagagaaacac
ggcaagaagccagtcaaagagaaccagagtgagggcaagggcagtgacagtgacagtgaa
ggggataatccggagaaaaagaaactgcaagaacagctgatgggtgccgtcgtgatggag
aagcccaacatacggtggaacgacgtggccgggctggagggggccaaggaggccctcaaa
gaagctgtcattttgccaatcaaattcccacacttgttcacaggcaagcgcaccccctgg
cgggggattctgctgttcggaccccctggcacagggaaatcctacctggccaaagccgtg
gcaacagaggccaacaactccaccttcttctctgtgtcctcctcagatctgatgtccaag
tggctgggggagagtgaaaagctggtcaagaacctgtttgagctggccaggcagcacaag
ccctccatcatcttcatcgatgaggtggattccctctgcgggtcccgaaatgaaaatgag
agtgaggccgcccggaggatcaaaacggagttcttggtccagatgcagggggtggggaat
aacaatgatgggactctggttcttggagccacaaacatcccatgggtgttggattcggcc
atcaggaggaggtttgaaaaacgaatttatatccccttgccggaggaagctgcccgcgcc
cagatgttccggttgcatctcgggagcactccccacaacctcacggatgcaaacatccac
gagctggcccggaagacggaaggctactcgggcgcggacatcagcatcatcgtgcgggac
tctctcatgcagcccgtgaggaaggtgcagtcggccacacacttcaaaaaggtctgtggc
ccctctcgcaccaaccccagcatgatgattgatgacctcctgactccatgctcaccaggg
gacccaggagccatggagatgacttggatggatgtccctggggacaaactcttagagcct
gtggtttgcatgtcggacatgctgcggtctctggccaccacccggcccacggtgaatgca
gacgacctcctgaaagtgaagaaattctcagaggactttgggcaagagagttaa

DBGET integrated database retrieval system