KEGG   Homo sapiens (human): 27235Help
Entry
27235             CDS       T01001                                 

Gene name
COQ2, CL640, COQ10D1, MSA1
Definition
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase (EC:2.5.1.39)
Orthology
K06125  
4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Module
Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone
Disease
H00999  
Coenzyme Q10 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    27235 (COQ2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     27235 (COQ2)
Prenyltransferases [BR:hsa01006]
 Compound prenylation
  4HB prenyltransferase
   27235 (COQ2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.23
AA seq 421 aa AA seqDB search
MTPISQVRMRKGSAHTAAQPGRLGLHPAGATAHACRGMTSIRARPGLTSAMLGSRAAGFA
RGLRAVALAWLPGWRGRSFALARAAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRP
LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAILMRGAGCTIN
DMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIALGAGSLL
LVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCDPSVCLPLYFSGVMWTLIYDTI
YAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAMLGALSLVGVNSGQTAPYYAALGAV
GAHLTHQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLGNLWKEKKTDKTKKGIENKIE
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaatttcacaagtaaggatgaggaaaggttctgcccacaccgccgcccagcct
ggcagactaggattgcatcctgcgggtgccactgcgcatgcctgccggggaatgacgtca
atccgagctcgtcccggcctcaccagcgccatgctgggctcgcgagccgcggggttcgcg
cggggcctgcgggctgtggcactggcgtggctgccgggctggcggggccgctccttcgcc
ctggcgcgtgcggcaggcgcgccccacggtggtgacttgcagccccccgcctgtcccgag
ccgcgcgggcgccagctcagtttgtccgcggcggcggtggtggactctgcgccccgcccc
ctgcagccgtacttgcgcctcatgcggttggacaagcccattggaacctggcttctgtat
ttaccatgtacctggagcattggtttggcagctgaaccaggttgttttccagattggtac
atgctctccctctttggcactggagctattctgatgcgtggagcaggctgtactattaat
gacatgtgggaccaggactatgataaaaaggttacaagaacagccaatcgtccaatagcc
gctggagacatttcaacttttcagtcctttgtttttcttgggggacagctaaccctggca
ctgggtgttcttctgtgtctaaattactacagtatagctctgggagcaggatccttactt
cttgtcatcacctacccactaatgaaaagaatttcatactggcctcaactagccttgggc
ttgacatttaattggggagcgttacttggatggtctgctatcaagggttcctgtgatcca
tctgtttgcctgcctctttatttttctggagttatgtggacactaatatatgatactatt
tatgcccatcaggacaaaagagatgatgttttgattggtcttaagtcaacggctctgcgg
ttcggagaaaataccaagccgtggctcagcggcttcagtgttgcaatgctgggggcactg
agcctagtgggtgtgaacagtggacagactgctccctactacgctgccctgggtgctgta
ggagcccatctgactcaccagatttacactctagacatccacagacctgaggattgttgg
aataaatttatctccaaccgaacactgggactaatagtttttttagggattgtccttggg
aatttgtggaaagaaaagaagacagacaaaacaaagaagggtatagagaataaaatagaa
aattaa

DBGET integrated database retrieval system