KEGG   Homo sapiens (human): 27236Help
Entry
27236             CDS       T01001                                 

Gene name
ARFIP1, HSU52521
Definition
(RefSeq) ADP ribosylation factor interacting protein 1
  KO
K20314  
arfaptin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q31.3
AA seq 373 aa AA seqDB search
MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGV
IEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNP
AMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQ
TLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIA
SVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAH
KEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLK
TPGVDAPSWLEEQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagaatctcccaaaaattcagcagcagaaattccagtgactagtaatggagaa
gttgatgactctcgtgaacatagctttaatagggatttgaagcattcattaccatctgga
cttggtctctcagaaacccaaattacatctcatggctttgacaataccaaagagggtgtt
attgaagcaggagcatttcaaggttccccagcaccgccactgccatctgttatgtctcct
agcagggttgcagctagtcgactggctcagcaaggaagtgatttaattgttcctgcaggt
ggccagagaacacagacaaaaagtggaccagttattctagcagatgaaattaaaaatcct
gcaatggaaaagttagaacttgttagaaaatggagtctaaacacctataagtgtactcga
cagattatctctgagaagctaggccgtggctcaagaactgtggaccttgaacttgaagct
cagattgatatattaagggataacaagaaaaaatatgaaaatattttaaaactggctcaa
acattgtcgacccagcttttccagatggtacatacccaaaggcaacttggagatgcattt
gctgacctgagtttgaagtcactagaacttcatgaagaatttggctataatgccgatacc
cagaaactgctggctaaaaatggagagactcttcttggggccattaattttttcattgct
agtgtgaacactttggtgaataaaaccattgaagatacattaatgactgtgaaacagtat
gaaagtgccaggattgaatatgatgcatatcgcactgatttggaagaactgaatcttgga
ccacgtgacgcaaacactctgccaaagattgagcagtcacagcatctcttccaagcacat
aaggaaaaatatgataaaatgcgcaatgatgtttctgtcaaattgaaatttctagaagaa
aataaggttaaagtattgcacaatcagctggtccttttccacaatgccattgccgcttac
tttgctgggaatcagaagcagcttgaacagacacttaaacagttccatatcaaattgaaa
acccctggagtggatgccccatcttggcttgaagaacagtaa

DBGET integrated database retrieval system