KEGG   Homo sapiens (human): 27242Help
Entry
27242             CDS       T01001                                 

Gene name
TNFRSF21, BM-018, CD358, DR6
Definition
tumor necrosis factor receptor superfamily, member 21
Orthology
K05157  
tumor necrosis factor receptor superfamily member 21
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27242 (TNFRSF21)
Cellular antigens [BR:hsa04090]
 Proteins
  27242 (TNFRSF21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 655 aa AA seqDB search
MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRA
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEK
LPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVP
SSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTSPSPGTAIFPRPEHMETHE
VPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNH
QQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHLPWMIVLFLLL
VLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEP
SPQDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggggacctctccgagcagcagcaccgccctcgcctcctgcagccgcatcgcccgccga
gccacagccacgatgatcgcgggctcccttctcctgcttggattccttagcaccaccaca
gctcagccagaacagaaggcctcgaatctcattggcacataccgccatgttgaccgtgcc
accggccaggtgctaacctgtgacaagtgtccagcaggaacctatgtctctgagcattgt
accaacacaagcctgcgcgtctgcagcagttgccctgtggggacctttaccaggcatgag
aatggcatagagaaatgccatgactgtagtcagccatgcccatggccaatgattgagaaa
ttaccttgtgctgccttgactgaccgagaatgcacttgcccacctggcatgttccagtct
aacgctacctgtgccccccatacggtgtgtcctgtgggttggggtgtgcggaagaaaggg
acagagactgaggatgtgcggtgtaagcagtgtgctcggggtaccttctcagatgtgcct
tctagtgtgatgaaatgcaaagcatacacagactgtctgagtcagaacctggtggtgatc
aagccggggaccaaggagacagacaacgtctgtggcacactcccgtccttctccagctcc
acctcaccttcccctggcacagccatctttccacgccctgagcacatggaaacccatgaa
gtcccttcctccacttatgttcccaaaggcatgaactcaacagaatccaactcttctgcc
tctgttagaccaaaggtactgagtagcatccaggaagggacagtccctgacaacacaagc
tcagcaagggggaaggaagacgtgaacaagaccctcccaaaccttcaggtagtcaaccac
cagcaaggcccccaccacagacacatcctgaagctgctgccgtccatggaggccactggg
ggcgagaagtccagcacgcccatcaagggccccaagaggggacatcctagacagaaccta
cacaagcattttgacatcaatgagcatttgccctggatgattgtgcttttcctgctgctg
gtgcttgtggtgattgtggtgtgcagtatccggaaaagctcgaggactctgaaaaagggg
ccccggcaggatcccagtgccattgtggaaaaggcagggctgaagaaatccatgactcca
acccagaaccgggagaaatggatctactactgcaatggccatggtatcgatatcctgaag
cttgtagcagcccaagtgggaagccagtggaaagatatctatcagtttctttgcaatgcc
agtgagagggaggttgctgctttctccaatgggtacacagccgaccacgagcgggcctac
gcagctctgcagcactggaccatccggggccccgaggccagcctcgcccagctaattagc
gccctgcgccagcaccggagaaacgatgttgtggagaagattcgtgggctgatggaagac
accacccagctggaaactgacaaactagctctcccgatgagccccagcccgcttagcccg
agccccatccccagccccaacgcgaaacttgagaattccgctctcctgacggtggagcct
tccccacaggacaagaacaagggcttcttcgtggatgagtcggagccccttctccgctgt
gactctacatccagcggctcctccgcgctgagcaggaacggttcctttattaccaaagaa
aagaaggacacagtgttgcggcaggtacgcctggacccctgtgacttgcagcctatcttt
gatgacatgctccactttctaaatcctgaggagctgcgggtgattgaagagattccccag
gctgaggacaaactagaccggctattcgaaattattggagtcaagagccaggaagccagc
cagaccctcctggactctgtttatagccatcttcctgacctgctgtag

DBGET integrated database retrieval system