KEGG   Homo sapiens (human): 27243Help
Entry
27243             CDS       T01001                                 

Gene name
CHMP2A, BC-2, BC2, CHMP2, VPS2, VPS2A
Definition
charged multivesicular body protein 2A
Orthology
K12191  
charged multivesicular body protein 2A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    27243 (CHMP2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   27243 (CHMP2A)
  Exosomal proteins of other body fluids (saliva and urine)
   27243 (CHMP2A)
  Exosomal proteins of colorectal cancer cells
   27243 (CHMP2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q
AA seq 222 aa AA seqDB search
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacctattgttcgggcgccggaagacgccagaggagctactgcggcagaaccagagg
gccctgaaccgtgccatgcgggagctggaccgcgagcgacagaaactagagacccaggag
aagaaaatcattgcagacattaagaagatggccaagcaaggccagatggatgctgttcgc
atcatggcaaaagacttggtgcgcacccggcgctatgtgcgcaagtttgtattgatgcgg
gccaacatccaggctgtgtccctcaagatccagacactcaagtccaacaactcgatggca
caagccatgaagggtgtcaccaaggccatgggcaccatgaacagacagctgaagttgccc
cagatccagaagatcatgatggagtttgagcggcaggcagagatcatggatatgaaggag
gagatgatgaatgatgccattgatgatgccatgggtgatgaggaagatgaagaggagagt
gatgctgtggtgtcccaggttctggatgagctgggacttagcctaacagatgagctgtcg
aacctcccctcaactgggggctcgcttagtgtggctgctggtgggaaaaaagcagaggcc
gcagcctcagccctagctgatgctgatgcagacctggaggaacggcttaagaacctgcgg
agggactga

DBGET integrated database retrieval system