KEGG   Homo sapiens (human): 27244Help
Entry
27244             CDS       T01001                                 

Gene name
SESN1, PA26, SEST1
Definition
sestrin 1
Orthology
K10141  
sestrin
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    27244 (SESN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 492 aa AA seqDB search
MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQV
GSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYI
GIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITK
EHIEGLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSN
YCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASR
FEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHG
YSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDY
DYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAEL
LYALRAITRYMT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttggccgccgccgcgaacgaggcgtacacggcccctttggcggtctcggggctg
ctgggctgcaagcagtgcggcgggggccgcgaccaggacgaggaacttggcattagaatt
cctcgaccactaggacagggaccaagcagattcatcccagaaaaggagatcctccaagtg
gggagtgaagacgcacagatgcatgctttatttgcagattcttttgctgctttgggccgt
ttggataacattacgttagtgatggttttccacccacaatatttagaaagtttcttaaaa
actcagcactatctactgcaaatggatgggccgttacccctacattatcgtcactacatt
ggaataatggctgcggcaagacatcagtgctcctacttagtgaacctgcatgtaaatgat
ttccttcatgttggtggggaccccaagtggctcaatggtttagagaatgctcctcaaaaa
ctacagaatttaggagaacttaacaaagtgttagcccatagaccttggcttattaccaaa
gaacacattgagggacttttaaaagctgaagagcacagctggtcccttgcggaattggta
catgcagtagttttactcacacactatcattctcttgcctcattcacattcggctgtgga
atcagtccagaaattcattgtgatggtggccacacattcagacctccttctgttagcaac
tactgcatctgtgacattacaaatggcaatcacagtgtggatgagatgccggtcaactca
gcagaaaatgtttctgtaagtgattctttctttgaggttgaagccctcatggaaaagatg
aggcagttacaggaatgtcgagatgaagaagaggcaagtcaggaagagatggcttcacgt
tttgaaatagaaaaaagagagagtatgtttgtcttctcttcagatgatgaagaagttaca
ccagcaagagctgtatctcgtcattttgaggatactagttatggctataaagatttctct
agacatgggatgcatgttccaacatttcgtgtccaggactattgctgggaagatcatggt
tattctttggtaaatcgcctttatccagatgtgggacagttgattgatgaaaaatttcac
attgcttacaatcttacttataatacaatggcaatgcacaaagatgttgatacctcaatg
cttagacgggcaatttggaactatattcactgcatgtttggaataagatatgatgattat
gactatggtgaaattaaccagctattggatcgtagctttaaagtttatatcaaaactgtt
gtttgcactcctgaaaaggttaccaaaagaatgtatgatagcttctggaggcagttcaag
cactctgagaaggttcatgttaatctgcttcttatagaagctaggatgcaagcagaactc
ctttatgctctgagagccattacccgctatatgacctga

DBGET integrated database retrieval system