KEGG   Homo sapiens (human): 2729Help
Entry
2729              CDS       T01001                                 

Gene name
GCLC, GCL, GCS, GLCL, GLCLC
Definition
(RefSeq) glutamate-cysteine ligase catalytic subunit (EC:6.3.2.2)
  KO
K11204  
glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Disease
H00668  
Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2729 (GCLC)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2729 (GCLC)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     2729 (GCLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12
AA seq 637 aa AA seqDB search
MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDH
ENKKVRLVLSGEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EANMRKRRKEATSILEENQALCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAI
NKHPRFSTLTRNIRHRRGEKVVINVPIFKDKNTPSPFIETFTEDDEASRASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQ
EGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVL
QGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNS
YLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYS
LILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgtcccagggctcgccgctgagctgggaggaaaccaagcgccatgccgac
cacgtgcggcggcacgggatcctccagttcctgcacatctaccacgccgtcaaggaccgg
cacaaggacgttctcaagtggggcgatgaggtggaatacatgttggtatcttttgatcat
gaaaataaaaaagtccggttggtcctgtctggggagaaagttcttgaaactctgcaagag
aagggggaaaggacaaacccaaaccatcctaccctttggagaccagagtatgggagttac
atgattgaagggacaccaggacagccctacggaggaacaatgtccgagttcaatacagtt
gaggccaacatgcgaaaacgccggaaggaggctacttctatattagaagaaaatcaggct
ctttgcacaataacttcatttcccagattaggctgtcctgggttcacactgcccgaggtc
aaacccaacccagtggaaggaggagcttccaagtccctcttctttccagatgaagcaata
aacaagcaccctcgcttcagtaccttaacaagaaatatccgacataggagaggagaaaag
gttgtcatcaatgtaccaatatttaaggacaagaatacaccatctccatttatagaaaca
tttactgaggatgatgaagcttcaagggcttctaagccggatcatatttacatggatgcc
atgggatttggaatgggcaattgctgtctccaggtgacattccaagcctgcagtatatct
gaggccagatacctttatgatcagttggctactatctgtccaattgttatggctttgagt
gctgcatctcccttttaccgaggctatgtgtcagacattgattgtcgctggggagtgatt
tctgcatctgtagatgatagaactcgggaggagcgaggactggagccattgaagaacaat
aactataggatcagtaaatcccgatatgactcaatagacagctatttatctaagtgtggt
gagaaatataatgacatcgacttgacgatagataaagagatctacgaacagctgttgcag
gaaggcattgatcatctcctggcccagcatgttgctcatctctttattagagacccactg
acactgtttgaagagaaaatacacctggatgatgctaatgagtctgaccattttgagaat
attcagtccacaaattggcagacaatgagatttaagccccctcctccaaactcagacatt
ggatggagagtagaatttcgacccatggaggtgcaattaacagactttgagaactctgcc
tatgtggtgtttgtggtactgctcaccagagtgatcctttcctacaaattggattttctc
attccactgtcaaaggttgatgagaacatgaaggtagcacagaaaagagatgctgtcttg
cagggaatgttttatttcaggaaagatatttgcaaaggtggcaatgcagtggtggatggt
tgtggcaaggcccagaacagcacggagctcgctgcagaggagtacaccctcatgagcata
gacaccatcatcaatgggaaggaaggtgtgtttcctggactgatcccaattctgaactct
taccttgaaaacatggaagtggatgtggacaccagatgtagtattctgaactacctaaag
ctaattaagaagagagcatctggagaactaatgacagttgccagatggatgagggagttt
atcgcaaaccatcctgactacaagcaagacagtgtcataactgatgaaatgaattatagc
cttattttgaagtgtaaccaaattgcaaatgaattatgtgaatgcccagagttacttgga
tcagcatttaggaaagtaaaatatagtggaagtaaaactgactcatccaactag

DBGET integrated database retrieval system