KEGG   Homo sapiens (human): 2729Help
Entry
2729              CDS       T01001                                 

Gene name
GCLC, GCL, GCS, GLCL, GLCLC
Definition
(RefSeq) glutamate-cysteine ligase catalytic subunit
  KO
K11204  
glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Disease
H00668  
Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2729 (GCLC)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2729 (GCLC)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    2729 (GCLC)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     2729 (GCLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P48506(Tchem)
UniProt: 
Position
6p12.1
AA seq 637 aa AA seqDB search
MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDH
ENKKVRLVLSGEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EANMRKRRKEATSILEENQALCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAI
NKHPRFSTLTRNIRHRRGEKVVINVPIFKDKNTPSPFIETFTEDDEASRASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQ
EGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVL
QGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNS
YLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYS
LILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgtcccagggctcgccgctgagctgggaggaaaccaagcgccatgccgac
cacgtgcggcggcacgggatcctccagttcctgcacatctaccacgccgtcaaggaccgg
cacaaggacgttctcaagtggggcgatgaggtggaatacatgttggtatcttttgatcat
gaaaataaaaaagtccggttggtcctgtctggggagaaagttcttgaaactctgcaagag
aagggggaaaggacaaacccaaaccatcctaccctttggagaccagagtatgggagttac
atgattgaagggacaccaggacagccctacggaggaacaatgtccgagttcaatacagtt
gaggccaacatgcgaaaacgccggaaggaggctacttctatattagaagaaaatcaggct
ctttgcacaataacttcatttcccagattaggctgtcctgggttcacactgcccgaggtc
aaacccaacccagtggaaggaggagcttccaagtccctcttctttccagatgaagcaata
aacaagcaccctcgcttcagtaccttaacaagaaatatccgacataggagaggagaaaag
gttgtcatcaatgtaccaatatttaaggacaagaatacaccatctccatttatagaaaca
tttactgaggatgatgaagcttcaagggcttctaagccggatcatatttacatggatgcc
atgggatttggaatgggcaattgctgtctccaggtgacattccaagcctgcagtatatct
gaggccagatacctttatgatcagttggctactatctgtccaattgttatggctttgagt
gctgcatctcccttttaccgaggctatgtgtcagacattgattgtcgctggggagtgatt
tctgcatctgtagatgatagaactcgggaggagcgaggactggagccattgaagaacaat
aactataggatcagtaaatcccgatatgactcaatagacagctatttatctaagtgtggt
gagaaatataatgacatcgacttgacgatagataaagagatctacgaacagctgttgcag
gaaggcattgatcatctcctggcccagcatgttgctcatctctttattagagacccactg
acactgtttgaagagaaaatacacctggatgatgctaatgagtctgaccattttgagaat
attcagtccacaaattggcagacaatgagatttaagccccctcctccaaactcagacatt
ggatggagagtagaatttcgacccatggaggtgcaattaacagactttgagaactctgcc
tatgtggtgtttgtggtactgctcaccagagtgatcctttcctacaaattggattttctc
attccactgtcaaaggttgatgagaacatgaaggtagcacagaaaagagatgctgtcttg
cagggaatgttttatttcaggaaagatatttgcaaaggtggcaatgcagtggtggatggt
tgtggcaaggcccagaacagcacggagctcgctgcagaggagtacaccctcatgagcata
gacaccatcatcaatgggaaggaaggtgtgtttcctggactgatcccaattctgaactct
taccttgaaaacatggaagtggatgtggacaccagatgtagtattctgaactacctaaag
ctaattaagaagagagcatctggagaactaatgacagttgccagatggatgagggagttt
atcgcaaaccatcctgactacaagcaagacagtgtcataactgatgaaatgaattatagc
cttattttgaagtgtaaccaaattgcaaatgaattatgtgaatgcccagagttacttgga
tcagcatttaggaaagtaaaatatagtggaagtaaaactgactcatccaactag

DBGET integrated database retrieval system