KEGG   Homo sapiens (human): 273Help
Entry
273               CDS       T01001                                 

Gene name
AMPH, AMPH1
Definition
(RefSeq) amphiphysin
  KO
K12562  
amphiphysin
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    273 (AMPH)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    273 (AMPH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14-p13
AA seq 695 aa AA seqDB search
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHAD
KAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTRKG
PPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFK
PEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSM
ICNLAESEQAPPTEPKAEEPLAAVTPAVGLDLGMDTRAEEPVEEAVIIPGADADAAVGTL
VSAAEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVI
PSVVIEPASNHEEEGENEITIGAEPKETTEDAAPPGPTSETPELATEQKPIQDPQPTPSA
PAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQ
DAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcaagacgggcatcttcgccaagaacgtccagaagcgactcaaccgcgcg
caggaaaaggtcctccaaaagctggggaaagctgatgagacaaaagacgaacagttcgaa
gaatatgtccagaacttcaaacggcaagaagcagagggtaccagacttcagcgagaactc
cgaggatatttagcagcaatcaaaggcatgcaggaggcctccatgaagctcacagagtcg
ctgcatgaagtctatgagcctgactggtatgggcgggaagatgtgaaaatggttggtgag
aaatgtgatgtgctgtgggaagacttccatcaaaaactcgtggatgggtccttgctaaca
ctggatacctacctggggcaatttcctgacataaagaatcgcatcgccaagcgcagcagg
aagctagtggactatgacagtgcccgccaccatctggaagctctgcagagctccaagagg
aaggatgagagtcgaatctctaaggcagaagaagaatttcagaaagcacagaaagtgttt
gaagagtttaacgttgacttacaagaagagttaccatcattatggtcaagacgagttgga
ttttatgttaatactttcaaaaacgtctccagccttgaagccaagtttcataaggaaatt
gcggtgctttgccacaaactgtatgaagtgatgacaaaactgggtgaccagcacgccgac
aaggccttcaccatccaaggagcgcccagtgattcgggtcctctccgcattgcaaagaca
ccatcaccgcctgaggagccttcacccctcccgagcccgacagcaagtccaaatcataca
ttagcacctgcgtctcccgcaccagcacggcctcggtcaccttcacagacaaggaaaggg
cctcctgtcccacctctacctaaagtcaccccgacaaaggaactgcagcaggagaacatc
atcagtttctttgaggacaactttgttccagaaatcagtgtgacaacaccttcccagaat
gaagtccctgaggtgaagaaagaggagactttgctggatctggactttgatcctttcaag
cccgaggtgacacctgcaggttctgctggagtgacccactcacccatgtctcagacattg
ccctgggacctatggacgacaagcactgatttggtacagccggcttctggtggttcattt
aatggattcacacagccccaggatacttcattattcacaatgcagacagaccagagtatg
atctgcaacttggctgaatctgaacaggctccacccacagagccaaaagcagaggagcct
ctggctgctgtcacacctgccgttggtctggaccttggaatggacactcgggctgaggag
ccagtggaggaggcagtgatcatacctggagctgatgctgatgcagctgttggaaccttg
gtgtcagcagctgagggggccccaggagaggaagcagaggcggagaaggccactgtccct
gccggggaaggagtaagtttagaggaggccaaaattggaactgaaaccactgagggtgca
gagagtgcccaacctgaagcagaggagctcgaagcaacagtgcctcaggagaaggtcatt
ccttcggtggtcatagagcctgcctccaaccatgaagaggaaggagaaaacgaaataact
ataggtgcagagcccaaggagaccaccgaggacgcggctcctccgggccccaccagcgag
acaccggagctggctacggagcagaagcctatccaggaccctcagcccacgccttctgca
ccagccatgggggctgctgaccagctagcatctgcaagggaggcctctcaggaattgcct
cctggctttctctacaaggtggaaacactgcatgattttgaggcagcaaattctgatgaa
cttaccttacaaaggggtgatgtggtgctggtggtcccctcagattcagaagctgatcag
gatgcaggctggctggtgggagtgaaggaatcagactggcttcagtacagagaccttgcc
acctacaaaggcctctttccagagaacttcacccgacgcttagattag

DBGET integrated database retrieval system