KEGG   Homo sapiens (human): 2730Help
Entry
2730              CDS       T01001                                 

Gene name
GCLM, GLCLR
Definition
(RefSeq) glutamate-cysteine ligase modifier subunit
  KO
K11205  glutamate--cysteine ligase regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa04216  Ferroptosis
Module
hsa_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2730 (GCLM)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2730 (GCLM)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    2730 (GCLM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 2730
NCBI-ProteinID: NP_002052
OMIM: 601176
HGNC: 4312
Ensembl: ENSG00000023909
Vega: OTTHUMG00000010562
Pharos: P48507(Tbio)
UniProt: P48507
Position
1p22.1
AA seq 274 aa AA seqDB search
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgacagccgcgcggccaaggcgctcctggcgcgggcccgcaccctgcacctg
cagacggggaacctgctgaactggggccgcctgcggaagaagtgcccgtccacgcacagc
gaggagcttcatgattgtatccaaaaaaccttgaatgaatggagttcccaaatcaaccca
gatttggtcagggagtttccagatgtcttggaatgcactgtatctcatgcagtagaaaag
ataaatcctgatgaaagagaagaaatgaaagtttctgcaaaactgttcattgtagaatca
aactcttcatcatcaactagaagtgcagttgacatggcctgttcagtccttggagttgca
cagctggattctgtgatcattgcttcacctcctattgaagatggagttaatctttccttg
gagcatttacagccttactgggaggaattagaaaacttagttcagagcaaaaagattgtt
gccataggtacctctgatctagacaaaacacagttggaacagctgtatcagtgggcacag
gtaaaaccaaatagtaaccaagttaatcttgcctcctgctgtgtgatgccaccagatttg
actgcatttgctaaacaatttgacatacagctgttgactcacaatgatccaaaagaactg
ctttctgaagcaagtttccaagaagctcttcaggaaagcattcctgacattcaagcgcac
gagtgggtgccgctgtggctactgcggtattcggtcattgtgaaaagtagaggaattatc
aaatcaaaaggctacattttacaagctaaaagaaggggttcttaa

DBGET integrated database retrieval system