KEGG   Homo sapiens (human): 2730Help
Entry
2730              CDS       T01001                                 

Gene name
GCLM, GLCLR
Definition
(RefSeq) glutamate-cysteine ligase modifier subunit
  KO
K11205  
glutamate--cysteine ligase regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Glutathione metabolism
Metabolic pathways
Ferroptosis
Module
Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2730 (GCLM)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2730 (GCLM)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    2730 (GCLM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P48507(Tbio)
UniProt: 
Position
1p22.1
AA seq 274 aa AA seqDB search
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgacagccgcgcggccaaggcgctcctggcgcgggcccgcaccctgcacctg
cagacggggaacctgctgaactggggccgcctgcggaagaagtgcccgtccacgcacagc
gaggagcttcatgattgtatccaaaaaaccttgaatgaatggagttcccaaatcaaccca
gatttggtcagggagtttccagatgtcttggaatgcactgtatctcatgcagtagaaaag
ataaatcctgatgaaagagaagaaatgaaagtttctgcaaaactgttcattgtagaatca
aactcttcatcatcaactagaagtgcagttgacatggcctgttcagtccttggagttgca
cagctggattctgtgatcattgcttcacctcctattgaagatggagttaatctttccttg
gagcatttacagccttactgggaggaattagaaaacttagttcagagcaaaaagattgtt
gccataggtacctctgatctagacaaaacacagttggaacagctgtatcagtgggcacag
gtaaaaccaaatagtaaccaagttaatcttgcctcctgctgtgtgatgccaccagatttg
actgcatttgctaaacaatttgacatacagctgttgactcacaatgatccaaaagaactg
ctttctgaagcaagtttccaagaagctcttcaggaaagcattcctgacattcaagcgcac
gagtgggtgccgctgtggctactgcggtattcggtcattgtgaaaagtagaggaattatc
aaatcaaaaggctacattttacaagctaaaagaaggggttcttaa

DBGET integrated database retrieval system