KEGG   Homo sapiens (human): 2730Help
Entry
2730              CDS       T01001                                 

Gene name
GCLM, GLCLR
Definition
(RefSeq) glutamate-cysteine ligase modifier subunit
  KO
K11205  
glutamate--cysteine ligase regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2730 (GCLM)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2730 (GCLM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P48507(Tbio)
UniProt: 
Position
1p22.1
AA seq 274 aa AA seqDB search
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgacagccgcgcggccaaggcgctcctggcgcgggcccgcaccctgcacctg
cagacggggaacctgctgaactggggccgcctgcggaagaagtgcccgtccacgcacagc
gaggagcttcatgattgtatccaaaaaaccttgaatgaatggagttcccaaatcaaccca
gatttggtcagggagtttccagatgtcttggaatgcactgtatctcatgcagtagaaaag
ataaatcctgatgaaagagaagaaatgaaagtttctgcaaaactgttcattgtagaatca
aactcttcatcatcaactagaagtgcagttgacatggcctgttcagtccttggagttgca
cagctggattctgtgatcattgcttcacctcctattgaagatggagttaatctttccttg
gagcatttacagccttactgggaggaattagaaaacttagttcagagcaaaaagattgtt
gccataggtacctctgatctagacaaaacacagttggaacagctgtatcagtgggcacag
gtaaaaccaaatagtaaccaagttaatcttgcctcctgctgtgtgatgccaccagatttg
actgcatttgctaaacaatttgacatacagctgttgactcacaatgatccaaaagaactg
ctttctgaagcaagtttccaagaagctcttcaggaaagcattcctgacattcaagcgcac
gagtgggtgccgctgtggctactgcggtattcggtcattgtgaaaagtagaggaattatc
aaatcaaaaggctacattttacaagctaaaagaaggggttcttaa

DBGET integrated database retrieval system