KEGG   Homo sapiens (human): 27301Help
Entry
27301             CDS       T01001                                 

Gene name
APEX2, APE2, APEXL2, XTH2
Definition
APEX nuclease (apurinic/apyrimidinic endonuclease) 2 (EC:4.2.99.18)
Orthology
K10772  
AP endonuclease 2 [EC:4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Module
BER complex
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hsa03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xp11.21
AA seq 347 aa AA seqDB search
MRFYRLLQIRAEALLAAGSHVIILGDLNTAHRPIDHWDAVNLECFEEDPGRKWMDSLLSN
LGCQSASHVGPFIDSYRCFQPKQEGAFTCWSAVTGARHLNYGSRLDYVLGDRTLVIDTFQ
ASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPV
LEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRGQKNLKSYFQPSPSCPQASPDIE
LPSLPLMSALMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCGG
HREPCVMRTVKKPGPNLGRRFYMCARPRGPPTDPSSRCNFFLWSRPS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctatcgtttgctgcaaatccgagcagaagccctcctggcggcaggcagccat
gtgatcattctgggtgacctgaatacagcccaccgccccattgaccactgggatgcagtc
aacctggaatgctttgaagaggacccagggcgcaagtggatggacagcttgctcagtaac
ttggggtgccagtctgcctctcatgtagggcccttcatcgatagctaccgctgcttccaa
ccaaagcaggagggggccttcacctgctggtcagcagtcactggcgcccgccatctcaac
tatggctcccggcttgactatgtgctgggggacaggaccctggtcatagacacctttcag
gcctctttcctgctgcctgaggtgatgggctctgaccactgccctgtgggtgcagtcttg
agtgtgtcctctgtgcctgcaaaacagtgcccacctctgtgcacccgcttcctccctgag
tttgcaggcacccagctcaagatccttcgcttcctagttcctctcgaacaaagtcctgtg
ttggagcagtcgacgctgcagcacaacaatcaaacccgggtacagacatgccaaaacaaa
gcccaagtgcgctcaaccaggcctcagcccagtcaggttggctctagcagaggccagaaa
aacctgaagagctactttcagccctcccctagctgtccccaagcctctcctgacatagag
ctgcctagcctaccactgatgagcgccctcatgaccccgaagactccagaagagaaggca
gtggccaaagtggtgaaggggcaggccaagacttcagaagccaaagatgagaaggagtta
cggacctcattctggaagtctgtgctggcggggcccttgcgcacacccctctgtgggggc
cacagggagccatgtgtgatgcgtactgtgaagaagccaggacccaacttgggccgccgc
ttctacatgtgtgccaggccccggggtcctcccactgacccctcctcccggtgcaacttc
ttcctctggagcaggcccagctga

DBGET integrated database retrieval system