KEGG   Homo sapiens (human): 27301Help
Entry
27301             CDS       T01001                                 

Gene name
APEX2, APE2, APEXL2, XTH2, ZGRF2
Definition
APEX nuclease (apurinic/apyrimidinic endonuclease) 2 (EC:4.2.99.18)
Orthology
K10772  
AP endonuclease 2 [EC:4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Module
BER complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    27301 (APEX2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     27301 (APEX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xp11.21
AA seq 347 aa AA seqDB search
MRFYRLLQIRAEALLAAGSHVIILGDLNTAHRPIDHWDAVNLECFEEDPGRKWMDSLLSN
LGCQSASHVGPFIDSYRCFQPKQEGAFTCWSAVTGARHLNYGSRLDYVLGDRTLVIDTFQ
ASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPV
LEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRGQKNLKSYFQPSPSCPQASPDIE
LPSLPLMSALMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCGG
HREPCVMRTVKKPGPNLGRRFYMCARPRGPPTDPSSRCNFFLWSRPS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctatcgtttgctgcaaatccgagcagaagccctcctggcggcaggcagccat
gtgatcattctgggtgacctgaatacagcccaccgccccattgaccactgggatgcagtc
aacctggaatgctttgaagaggacccagggcgcaagtggatggacagcttgctcagtaac
ttggggtgccagtctgcctctcatgtagggcccttcatcgatagctaccgctgcttccaa
ccaaagcaggagggggccttcacctgctggtcagcagtcactggcgcccgccatctcaac
tatggctcccggcttgactatgtgctgggggacaggaccctggtcatagacacctttcag
gcctctttcctgctgcctgaggtgatgggctctgaccactgccctgtgggtgcagtcttg
agtgtgtcctctgtgcctgcaaaacagtgcccacctctgtgcacccgcttcctccctgag
tttgcaggcacccagctcaagatccttcgcttcctagttcctctcgaacaaagtcctgtg
ttggagcagtcgacgctgcagcacaacaatcaaacccgggtacagacatgccaaaacaaa
gcccaagtgcgctcaaccaggcctcagcccagtcaggttggctctagcagaggccagaaa
aacctgaagagctactttcagccctcccctagctgtccccaagcctctcctgacatagag
ctgcctagcctaccactgatgagcgccctcatgaccccgaagactccagaagagaaggca
gtggccaaagtggtgaaggggcaggccaagacttcagaagccaaagatgagaaggagtta
cggacctcattctggaagtctgtgctggcggggcccttgcgcacacccctctgtgggggc
cacagggagccatgtgtgatgcgtactgtgaagaagccaggacccaacttgggccgccgc
ttctacatgtgtgccaggccccggggtcctcccactgacccctcctcccggtgcaacttc
ttcctctggagcaggcccagctga

DBGET integrated database retrieval system