KEGG   Homo sapiens (human): 2731Help
Entry
2731              CDS       T01001                                 

Gene name
GLDC, GCE, GCSP, HYGN1
Definition
(RefSeq) glycine decarboxylase
  KO
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Disease
H00191  
Nonketotic hyperglycinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2731 (GLDC)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    2731 (GLDC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    2731 (GLDC)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     2731 (GLDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P23378(Tbio)
UniProt: 
Position
9p24.1
AA seq 1020 aa AA seqDB search
MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRH
DDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATL
HAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQ
TMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYT
GVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQSGSLACCATDLLALC
ILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEV
YRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSE
GLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKD
LDDLLWIFGCESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKK
LENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEK
DLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHM
AGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQH
GGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFL
PNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYM
AKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVA
GTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHW
DRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctgtgccagggcgtgggggctgcgcctgggccgcggggtcgggggcggccgc
cgcctggctgggggatcggggccgtgctgggcgccgcggagccgggacagcagcagtggc
ggcggggacagcgccgcggctggggcctcgcgcctcctggagcgccttctgcccagacac
gacgacttcgctcggaggcacatcggccctggggacaaagaccagagagagatgctgcag
accttggggctggcgagcattgatgaattgatcgagaagacggtccctgccaacatccgt
ttgaaaagacccttgaaaatggaagaccctgtttgtgaaaatgaaatccttgcaactctg
catgccatttcaagcaaaaaccagatctggagatcgtatattggcatgggctattataac
tgctcagtgccacagacgattttgcggaacttactggagaactcaggatggatcacccag
tatactccataccagcctgaggtgtctcaggggaggctggagagtttactcaactaccag
accatggtgtgtgacatcacaggcctggacatggccaatgcatccctgctggatgagggg
actgcagccgcagaggcactgcagctgtgctacagacacaacaagaggaggaaatttctc
gttgatccccgttgccacccacagacaatagctgttgtccagactcgagccaaatatact
ggagtcctcactgagctgaagttaccctgtgaaatggacttcagtggaaaagatgtcagt
ggagtgttgttccagtacccagacacggaggggaaggtggaagactttacggaactcgtg
gagagagctcatcagagtgggagcctggcctgctgtgctactgaccttttagctttgtgc
atcttgaggccacctggagaatttggggtagacatcgccctgggcagctcccagagattt
ggagtgccactgggctatgggggaccccatgcagcattttttgctgtccgagaaagcttg
gtgagaatgatgcctggaagaatggtgggggtaacaagagatgccactgggaaagaagtg
tatcgtcttgctcttcaaaccagggagcaacacattcggagagacaaggctaccagcaac
atctgtacagctcaggccctcttggcgaatatggctgccatgtttgcaatctaccatggt
tcccatgggctggagcatattgctaggagggtacataatgccactttgattttgtcagaa
ggtctcaagcgagcagggcatcaactccagcatgacctgttctttgataccttgaagatt
cagtgtggctgctcagtgaaggaggtcttgggcagggccgctcagcggcagatcaatttt
cggctttttgaggatggcacacttggtatttctcttgatgaaacagtcaatgaaaaagat
ctggacgatttgttgtggatctttggttgtgagtcatctgcagaactggttgctgaaagc
atgggagaggagtgcagaggtattccagggtctgtgttcaagaggaccagcccgttcctc
acccatcaagtgttcaacagctaccactctgaaacaaacattgtccggtacatgaagaaa
ctggaaaataaagacatttcccttgttcacagcatgattccactgggatcctgcaccatg
aaactgaacagttcgtctgaactcgcacctatcacatggaaagaatttgcaaacatccac
ccctttgtgcctctggatcaagctcaaggatatcagcagcttttccgagagcttgagaag
gatttgtgtgaactcacaggttatgaccaggtctgtttccagccaaacagcggagcccag
ggagaatatgctggactggccactatccgagcctacttaaaccagaaaggagaggggcac
agaacggtttgcctcattccgaaatcagcacatgggaccaacccagcaagtgcccacatg
gcaggcatgaagattcagcctgtggaggtggataaatatgggaatatcgatgcagttcac
ctcaaggccatggtggataagcacaaggagaacctagcagctatcatgattacataccca
tccaccaatggggtgtttgaagagaacatcagtgacgtgtgtgacctcatccatcaacat
ggaggacaggtctacctagacggggcaaatatgaatgctcaggtgggaatctgtcgccct
ggagacttcgggtctgatgtctcgcacctaaatcttcacaagaccttctgcattccccac
ggaggaggtggtcctggcatggggcccatcggagtgaagaaacatctcgccccgtttttg
cccaatcatcccgtcatttcactaaagcggaatgaggatgcctgtcctgtgggaaccgtc
agtgcggccccatggggctccagttccatcttgcccatttcctgggcttatatcaagatg
atgggaggcaagggtcttaaacaagccacggaaactgcgatattaaatgccaactacatg
gccaagcgattagaaacacactacagaattcttttcaggggtgcaagaggttatgtgggt
catgaatttattttggacacgagacccttcaaaaagtctgcaaatattgaggctgtggat
gtggccaagagactccaggattatggatttcacgcccctaccatgtcctggcctgtggca
gggaccctcatggtggagcccactgagtcggaggacaaggcagagctggacagattctgt
gatgccatgatcagcattcggcaggaaattgctgacattgaggagggccgcatcgacccc
agggtcaatccgctgaagatgtctccacactccctgacctgcgttacatcttcccactgg
gaccggccttattccagagaggtggcagcattcccactccccttcgtgaaaccagagaac
aaattctggccaacgattgcccggattgatgacatatatggagatcagcacctggtttgt
acctgcccacccatggaagtttatgagtctccattttctgaacaaaagagggcgtcttct
tag

DBGET integrated database retrieval system