KEGG   Homo sapiens (human): 27316Help
Entry
27316             CDS       T01001                                 

Gene name
RBMX, HNRNPG, HNRPG, RBMXP1, RBMXRT, RNMX, hnRNP-G
Definition
RNA binding motif protein, X-linked
Orthology
K12885  
heterogeneous nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq26.3
AA seq 196 aa AA seqDB search
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKLLYHVEEIVMEVHLEGNRCPLVEMFICPQEMMGILLKTAIQAEITQVL
VILEIMHHHHEIILTVIMVIPVHVMTIHQEDIAIEMDMVVIVTIQIIQVEVPTEIHMRVM
VGDFAHYGRGVLIDSQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaat
gagaaagctcttgaagcagtatttggcaaatatggacgaatagtggaagtactcttgatg
aaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagca
gacgctaaggatgcagccagagacatgaatggaaagctcctgtatcacgtggaagagata
gttatggaggtccacctcgaagggaaccgctgccctctcgtagagatgtttatttgtccc
caagagatgatgggtattctactaaagacagctattcaagcagagattacccaagttctc
gtgatactagagattatgcaccaccaccacgagattatacttaccgtgattatggtcatt
ccagttcacgtgatgactatccatcaagaggatatagcgatagagatggatatggtcgtg
atcgtgactattcagatcatccaagtggaggttcctacagagattcatatgagagttatg
gttggtgattttgctcattatggtcgtggagtgctgattgattcacagtag

DBGET integrated database retrieval system