KEGG   Homo sapiens (human): 27324Help
Entry
27324             CDS       T01001                                 

Gene name
TOX3, CAGF9, TNRC9
Definition
(RefSeq) TOX high mobility group box family member 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 IMUP
Motif
Other DBs
NCBI-GeneID: 27324
NCBI-ProteinID: NP_001073899
OMIM: 611416
HGNC: 11972
Ensembl: ENSG00000103460
Vega: OTTHUMG00000173222
Pharos: O15405(Tbio)
UniProt: O15405
Position
16q12.1
AA seq 576 aa AA seqDB search
MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLG
DEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISR
NLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQS
QLSAQLGLNLGGASMPHTSPSPPASKSATPSPSSSINEEDADEANRAIGEKRAAPDSGKK
PKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ
KQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNT
PLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG
TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQ
HFQHHMQQHLQQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQI
TSPIPAIGSPQPASQQHQSQIQSQTQTQVLSQVSIF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgaggttctaccccgcggcggccggggaccctgccagcctggacttcgcgcag
tgcctggggtactacggctacagcaagtttggaaataataataactatatgaatatggct
gaggcgaacaatgcgttcttcgctgccagtgagcagacattccacacaccaagccttggg
gacgaggaattcgaaattccaccaatcacgcctcctccagagtcagaccctgccctaggc
atgccggatgtactgctaccctttcaagccctcagcgatccattgccttcccagggaagt
gaattcacaccccagtttccccctcaaagcctggacctcccttccattacaatctcaaga
aatctcgtggaacaagatggcgtgcttcatagcagtgggttgcatatggatcagagccac
acacaagtgtcccagtaccggcaggatccctccctgatcatgcggtccatcgtccacatg
accgatgctgcgcgttctggggtcatgcctcctgcccagctcaccaccatcaaccagtct
cagctcagcgcccagttggggttgaatttgggaggtgccagtatgcctcacacatctcct
tcacctccagcaagcaaatcagccactccctccccttccagctccatcaatgaagaggat
gctgatgaagccaacagagccattggagagaaaagagctgctccagactctggcaagaag
cccaagactccaaagaaaaagaaaaagaaagatcccaatgagccacagaagccagtgtca
gcatatgccctgtttttcagagacacacaggctgcaattaaaggtcaaaaccccaatgca
acctttggagaggtctcaaaaattgtagcatctatgtgggacagccttggagaagaacaa
aagcaggtatataaaaggaaaacagaagctgccaaaaaagaatacctgaaggccctggcg
gcatacagggccagcctcgtttctaaggctgctgctgagtcagcagaagcccagaccatc
cgttctgttcagcagaccctggcgtcgaccaatctaacatcctctctccttctcaacact
ccactgtctcaacatggaacagtgtcagcatcacctcagactctccagcaatccctccct
aggtcaatcgctcccaaacccttaaccatgagactccccatgaaccagattgtcacatca
gtcaccattgcagccaacatgccctcgaacattggggctccactgataagctccatggga
acgaccatggttggctcagcaccctccacccaagtgagtccttcggtgcaaacccagcag
catcagatgcaattgcagcagcagcagcagcagcaacaacaacagatgcaacagatgcag
cagcagcaactccagcagcaccaaatgcatcagcaaatccagcagcagatgcagcagcag
catttccagcaccacatgcagcagcacctgcagcagcagcagcagcatctccagcagcaa
attaatcaacagcagctgcagcagcagctgcagcagcgcctccagctgcagcagctgcaa
cacatgcagcaccagtctcagccttctcctcggcagcactcccctgtcgcctctcagata
acatcccccatccctgccatcgggagcccccagccagcctctcagcagcaccagtcgcaa
atacagtctcagacacagactcaagtattatcgcaggtcagtattttctga

DBGET integrated database retrieval system