KEGG   Homo sapiens (human): 27324Help
Entry
27324             CDS       T01001                                 

Gene name
TOX3, CAGF9, TNRC9
Definition
(RefSeq) TOX high mobility group box family member 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
16q12.1
AA seq 576 aa AA seqDB search
MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLG
DEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISR
NLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQS
QLSAQLGLNLGGASMPHTSPSPPASKSATPSPSSSINEEDADEANRAIGEKRAAPDSGKK
PKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ
KQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNT
PLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG
TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQ
HFQHHMQQHLQQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQI
TSPIPAIGSPQPASQQHQSQIQSQTQTQVLSQVSIF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgaggttctaccccgcggcggccggggaccctgccagcctggacttcgcgcag
tgcctggggtactacggctacagcaagtttggaaataataataactatatgaatatggct
gaggcgaacaatgcgttcttcgctgccagtgagcagacattccacacaccaagccttggg
gacgaggaattcgaaattccaccaatcacgcctcctccagagtcagaccctgccctaggc
atgccggatgtactgctaccctttcaagccctcagcgatccattgccttcccagggaagt
gaattcacaccccagtttccccctcaaagcctggacctcccttccattacaatctcaaga
aatctcgtggaacaagatggcgtgcttcatagcagtgggttgcatatggatcagagccac
acacaagtgtcccagtaccggcaggatccctccctgatcatgcggtccatcgtccacatg
accgatgctgcgcgttctggggtcatgcctcctgcccagctcaccaccatcaaccagtct
cagctcagcgcccagttggggttgaatttgggaggtgccagtatgcctcacacatctcct
tcacctccagcaagcaaatcagccactccctccccttccagctccatcaatgaagaggat
gctgatgaagccaacagagccattggagagaaaagagctgctccagactctggcaagaag
cccaagactccaaagaaaaagaaaaagaaagatcccaatgagccacagaagccagtgtca
gcatatgccctgtttttcagagacacacaggctgcaattaaaggtcaaaaccccaatgca
acctttggagaggtctcaaaaattgtagcatctatgtgggacagccttggagaagaacaa
aagcaggtatataaaaggaaaacagaagctgccaaaaaagaatacctgaaggccctggcg
gcatacagggccagcctcgtttctaaggctgctgctgagtcagcagaagcccagaccatc
cgttctgttcagcagaccctggcgtcgaccaatctaacatcctctctccttctcaacact
ccactgtctcaacatggaacagtgtcagcatcacctcagactctccagcaatccctccct
aggtcaatcgctcccaaacccttaaccatgagactccccatgaaccagattgtcacatca
gtcaccattgcagccaacatgccctcgaacattggggctccactgataagctccatggga
acgaccatggttggctcagcaccctccacccaagtgagtccttcggtgcaaacccagcag
catcagatgcaattgcagcagcagcagcagcagcaacaacaacagatgcaacagatgcag
cagcagcaactccagcagcaccaaatgcatcagcaaatccagcagcagatgcagcagcag
catttccagcaccacatgcagcagcacctgcagcagcagcagcagcatctccagcagcaa
attaatcaacagcagctgcagcagcagctgcagcagcgcctccagctgcagcagctgcaa
cacatgcagcaccagtctcagccttctcctcggcagcactcccctgtcgcctctcagata
acatcccccatccctgccatcgggagcccccagccagcctctcagcagcaccagtcgcaa
atacagtctcagacacagactcaagtattatcgcaggtcagtattttctga

DBGET integrated database retrieval system