KEGG   Homo sapiens (human): 2733Help
Entry
2733              CDS       T01001                                 

Gene name
GLE1, GLE1L, LCCS, LCCS1, hGLE1
Definition
GLE1 RNA export mediator
Organism
hsa  Homo sapiens (human)
Disease
H00865  
Lethal congenital contractural syndrome (LCCS)
H01030  
Lethal arthrogryposis with anterior horn cell disease
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 698 aa AA seqDB search
MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHM
QENQPLSETSPSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESMVL
QSSRGIKVEGCVRMYELVHRMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQ
HKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE
GQIRLRALYALQEEMLQLSQQLDASEQHKALLKVDLAAFQTRGNQLCSLISGIIRASSES
SYPTAESQAEAERALREMRDLLMNLGQEITRACEDKRRQDEEEAQVKLQEAQMQQGPEAH
KEPPAPSQGPGGKQNEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKM
DLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQSGGRSVSVTLNPQGLDFVQYKL
AEKFVKQGEEEVASHHEAAFPIAVVASGIWELHPRVGDLILAHLHKKCPYSVPFYPTFKE
GMALEDYQRMLGYQVKDSKVEQQDNFLKRMSGMIRLYAAIIQLRWPYGNRQEIHPHGLNH
GWRWLAQILNMEPLSDVTATLLFDFLEVCGNALMKQYQVQFWKMLILIKEDYFPRIEAIT
SSGQMGSFIRLKQFLEKCLQHKDIPVPKGFLTSSFWRS
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgagggtcgctgctgggagaccttgaaggccctacgcagttccgacaaaggt
cgcctttgctactaccgcgactggctgctgcggcgcgaggatgttttagaagaatgtatg
tctcttcccaagctatcttcttattctggatgggtggtagagcacgtcctaccccatatg
caggagaaccaacctctgtctgagacttcgccatcctctacgtcagcttcagccctagat
caaccctcatttgttcccaaatctcctgacgcaagctctgccttttccccagcctcccct
gcaacaccaaatggaaccaagggcaaagatgagtcccagcacacagaatctatggtactt
cagtcctcacgggggatcaaagtggaaggctgcgtccgaatgtacgaactggtacacaga
atgaaaggaacagagggcctgaggctatggcaggaggagcaggagaggaaggtgcaagcc
ctctcggagatggcatctgaacaactgaagcggtttgatgaatggaaggaactgaagcag
cataaagaattccaggacttgcgggaagtaatggagaagagctccagagaagccttggga
caccaagagaagctaaaagctgagcaccgtcacagagcaaagattctcaacctgaagctg
cgggaagcagagcagcagcgcgtgaagcaagcagaacaggagcggcttcggaaggaagaa
ggccagatccgcctgcgggccctctatgctctgcaggaggagatgctgcagctcagccag
cagctggatgcctctgagcagcacaaagccctgcttaaggtcgacctggctgccttccag
acccgaggcaaccagctgtgcagcctcatctcagggatcatccgggcctcttcagagagc
agctatcccacagcagagagtcaagctgaggctgagcgagctctgcgggaaatgcgggac
ctcctgatgaacttggggcaggagatcaccagagcctgcgaagacaagaggaggcaggat
gaagaagaggcccaggtaaagctgcaagaggcacagatgcagcagggaccagaggcccac
aaagagcccccagctcccagccagggcccaggagggaaacagaatgaagacctccaggtg
aaggtacaagacattacaatgcagtggtaccagcagctgcaggatgcttccatgcagtgt
gtgttgacctttgagggcctgaccaacagcaaggacagtcaggccaaaaagataaagatg
gacctccagaaggctgctaccatcccagtgagccaaatctctaccattgcaggctcaaaa
ctgaaggagatctttgacaagatccacagcctgctctctggaaaacctgttcaatctggt
gggcgctctgtgtctgtcacacttaacccacaggggctggactttgttcaatacaaactg
gcagagaaatttgtgaaacaaggcgaggaggaagtggcctctcaccatgaagcagcattc
cccattgcagttgtggcatccgggatctgggagctccaccccagagtgggggacctcatt
cttgctcatctacataagaagtgtccttactctgttcctttctatcccactttcaaggag
ggaatggctttggaagactatcagaggatgcttggttaccaagtaaaggattccaaagtg
gagcagcaagacaactttctaaaacgcatgtcagggatgatccgtctctacgctgctatc
atccagctccggtggccatatggaaaccgacaggagattcaccctcatggcttaaatcat
ggatggcgctggttggcacagatcttaaacatggagcccttgtcagatgtgacagccacc
ctcctctttgacttcctggaggtgtgtgggaatgccctcatgaagcaataccaggttcag
ttctggaagatgctaattctcatcaaagaggactactttcccagaattgaagctatcaca
agctcaggacagatgggctccttcatacgcctcaagcagttcttggagaaatgtttgcaa
cacaaggacattcctgtccccaagggctttctgacttcctccttctggcgctcctga

DBGET integrated database retrieval system