KEGG   Homo sapiens (human): 27330Help
Entry
27330             CDS       T01001                                 

Gene name
RPS6KA6, PP90RSK4, RSK4
Definition
ribosomal protein S6 kinase, 90kDa, polypeptide 6 (EC:2.7.11.1)
Orthology
K04373  
p90 ribosomal S6 kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    27330 (RPS6KA6)
   04150 mTOR signaling pathway
    27330 (RPS6KA6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    27330 (RPS6KA6)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    27330 (RPS6KA6)
  Nervous system
   04720 Long-term potentiation
    27330 (RPS6KA6)
   04722 Neurotrophin signaling pathway
    27330 (RPS6KA6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27330 (RPS6KA6)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [Table]
   27330 (RPS6KA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xq21
AA seq 745 aa AA seqDB search
MLPFAPQDEPWDREMEVFSGGGASSGEVNGLKMVDEPMEEGEADSCHDEGVVKEIPITHH
VKEGYEKADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRT
KMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLA
ELALALDHLHQLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYM
APEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEA
QSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWDKLYKREVQPPFKPASGKPDDTFCF
DPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAA
QFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSKRDPSEEIEILMRYGQHPNI
ITLKDVFDDGRYVYLVTDLMKGGELLDRILKQKCFSEREASDILYVISKTVDYLHCQGVV
HRDLKPSNILYMDESASADSIRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYD
AACDIWSLGVLFYTMLAGYTPFANGPNDTPEEILLRIGNGKFSLSGGNWDNISDGAKDLL
SHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQ
PVLEPVAASSLAQRRSMKKRTSTGL
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgctaccattcgctcctcaggacgagccctgggaccgagaaatggaagtgttcagcggc
ggcggcgcgagcagcggcgaggtaaatggtcttaaaatggttgatgagccaatggaagag
ggagaagcagattcttgtcatgatgaaggagttgttaaagaaatccctattactcatcat
gttaaggaaggctatgagaaagcagatcctgcacagtttgagttgctcaaggttcttggt
caggggtcatttggaaaggtttttcttgttagaaagaagaccggtcctgatgctgggcag
ctctatgcaatgaaggtgttaaaaaaagcctctttaaaagttcgagacagagttcggaca
aagatggagagggatatactggtggaagtaaatcatccatttattgtcaaattgcactat
gcctttcagactgaagggaaactgtacttaatactggattttctcaggggaggagatgtt
ttcacaagattatccaaagaggttctgtttacagaggaagatgtgaaattctacctcgca
gaactggcccttgctttggatcatctgcaccaattaggaattgtttatagagacctgaag
ccagaaaacattttgcttgatgaaataggacatatcaaattaacagattttggactcagc
aaggagtcagtagatcaagaaaagaaggcttactcattttgtggtacagtagagtatatg
gctcctgaagtagtaaataggagaggccattcccagagtgctgattggtggtcatatggt
gttcttatgtttgaaatgcttactggtactctgccatttcaaggtaaagacagaaatgag
accatgaatatgatattaaaagcaaaacttggaatgcctcaatttcttagtgctgaagca
caaagtcttctaaggatgttattcaaaaggaatccagcaaatagattgggatcagaagga
gttgaagaaatcaaaagacatctgttttttgcaaatattgactgggataaattatataaa
agagaagttcaacctcctttcaaacctgcttctggaaaaccagatgatactttttgtttt
gatcctgaatttactgcaaaaacacctaaagattctcccggtttgccagccagtgcaaat
gctcatcagctcttcaaaggattcagctttgttgcaacttctattgcagaagaatataaa
atcactcctatcacaagtgcaaatgtattaccaattgttcagataaatggaaatgctgca
caatttggtgaagtatatgaattgaaggaggatattggtgttggctcctactctgtttgc
aagcgatgcatacatgcaactaccaacatggaatttgcagtgaagatcattgacaaaagt
aagcgagacccttcagaagagattgaaatattgatgcgctatggacaacatcccaacatt
attactttgaaggatgtctttgatgatggtagatatgtttaccttgttacggatttaatg
aaaggaggagagttacttgaccgtattctcaaacaaaaatgtttctcggaacgggaggct
agtgatatactatatgtaataagtaagacagttgactatcttcattgtcaaggagttgtt
catcgtgatcttaaacctagtaatattttatacatggatgaatcagccagtgcagattca
atcaggatatgtgattttgggtttgcaaaacaacttcgaggagaaaatggacttctctta
actccatgctacactgcaaactttgttgcacctgaggttcttatgcaacagggatatgat
gctgcttgtgatatctggagtttaggagtccttttttacacaatgttggctggctacact
ccatttgctaatggccccaatgatactcctgaagagatactgctgcgtataggcaatgga
aaattctctttgagtggtggaaactgggacaatatttcagacggagcaaaggatttgctt
tcccatatgcttcatatggacccacatcagcggtatactgctgaacaaatattaaagcac
tcatggataactcacagagaccagttgccaaatgatcagccaaagagaaatgatgtgtca
catgttgttaagggagcaatggttgcaacatactctgccctgactcacaagacctttcaa
ccagtcctagagcctgtagctgcttcaagcttagcccagcgacggagcatgaaaaagcga
acatcaactggcctgtaa

DBGET integrated database retrieval system