KEGG   Homo sapiens (human): 27330Help
Entry
27330             CDS       T01001                                 

Gene name
RPS6KA6, PP90RSK4, RSK-4, RSK4, S6K-alpha-6, p90RSK6
Definition
(RefSeq) ribosomal protein S6 kinase A6
  KO
K04373  
ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    27330 (RPS6KA6)
   04150 mTOR signaling pathway
    27330 (RPS6KA6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    27330 (RPS6KA6)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    27330 (RPS6KA6)
  Nervous system
   04720 Long-term potentiation
    27330 (RPS6KA6)
   04722 Neurotrophin signaling pathway
    27330 (RPS6KA6)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    27330 (RPS6KA6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27330 (RPS6KA6)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   27330 (RPS6KA6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     27330 (RPS6KA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UK32(Tchem)
UniProt: 
Position
Xq21.1
AA seq 745 aa AA seqDB search
MGLSTSAIWKNTRVEIVNPYEVKRKVKVNGLKMVDEPMEEGEADSCHDEGVVKEIPITHH
VKEGYEKADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRT
KMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLA
ELALALDHLHQLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYM
APEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEA
QSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWDKLYKREVQPPFKPASGKPDDTFCF
DPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAA
QFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSKRDPSEEIEILMRYGQHPNI
ITLKDVFDDGRYVYLVTDLMKGGELLDRILKQKCFSEREASDILYVISKTVDYLHCQGVV
HRDLKPSNILYMDESASADSIRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYD
AACDIWSLGVLFYTMLAGYTPFANGPNDTPEEILLRIGNGKFSLSGGNWDNISDGAKDLL
SHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQ
PVLEPVAASSLAQRRSMKKRTSTGL
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggtctctctacctcagcaatttggaaaaatactcgagtggaaattgttaatccctat
gaagtaaaacgaaaggtgaaggtaaatggtcttaaaatggttgatgagccaatggaagag
ggagaagcagattcttgtcatgatgaaggagttgttaaagaaatccctattactcatcat
gttaaggaaggctatgagaaagcagatcctgcacagtttgagttgctcaaggttcttggt
caggggtcatttggaaaggtttttcttgttagaaagaagaccggtcctgatgctgggcag
ctctatgcaatgaaggtgttaaaaaaagcctctttaaaagttcgagacagagttcggaca
aagatggagagggatatactggtggaagtaaatcatccatttattgtcaaattgcactat
gcctttcagactgaagggaaactgtacttaatactggattttctcaggggaggagatgtt
ttcacaagattatccaaagaggttctgtttacagaggaagatgtgaaattctacctcgca
gaactggcccttgctttggatcatctgcaccaattaggaattgtttatagagacctgaag
ccagaaaacattttgcttgatgaaataggacatatcaaattaacagattttggactcagc
aaggagtcagtagatcaagaaaagaaggcttactcattttgtggtacagtagagtatatg
gctcctgaagtagtaaataggagaggccattcccagagtgctgattggtggtcatatggt
gttcttatgtttgaaatgcttactggtactctgccatttcaaggtaaagacagaaatgag
accatgaatatgatattaaaagcaaaacttggaatgcctcaatttcttagtgctgaagca
caaagtcttctaaggatgttattcaaaaggaatccagcaaatagattgggatcagaagga
gttgaagaaatcaaaagacatctgttttttgcaaatattgactgggataaattatataaa
agagaagttcaacctcctttcaaacctgcttctggaaaaccagatgatactttttgtttt
gatcctgaatttactgcaaaaacacctaaagattctcccggtttgccagccagtgcaaat
gctcatcagctcttcaaaggattcagctttgttgcaacttctattgcagaagaatataaa
atcactcctatcacaagtgcaaatgtattaccaattgttcagataaatggaaatgctgca
caatttggtgaagtatatgaattgaaggaggatattggtgttggctcctactctgtttgc
aagcgatgcatacatgcaactaccaacatggaatttgcagtgaagatcattgacaaaagt
aagcgagacccttcagaagagattgaaatattgatgcgctatggacaacatcccaacatt
attactttgaaggatgtctttgatgatggtagatatgtttaccttgttacggatttaatg
aaaggaggagagttacttgaccgtattctcaaacaaaaatgtttctcggaacgggaggct
agtgatatactatatgtaataagtaagacagttgactatcttcattgtcaaggagttgtt
catcgtgatcttaaacctagtaatattttatacatggatgaatcagccagtgcagattca
atcaggatatgtgattttgggtttgcaaaacaacttcgaggagaaaatggacttctctta
actccatgctacactgcaaactttgttgcacctgaggttcttatgcaacagggatatgat
gctgcttgtgatatctggagtttaggagtccttttttacacaatgttggctggctacact
ccatttgctaatggccccaatgatactcctgaagagatactgctgcgtataggcaatgga
aaattctctttgagtggtggaaactgggacaatatttcagacggagcaaaggatttgctt
tcccatatgcttcatatggacccacatcagcggtatactgctgaacaaatattaaagcac
tcatggataactcacagagaccagttgccaaatgatcagccaaagagaaatgatgtgtca
catgttgttaagggagcaatggttgcaacatactctgccctgactcacaagacctttcaa
ccagtcctagagcctgtagctgcttcaagcttagcccagcgacggagcatgaaaaagcga
acatcaactggcctgtaa

KEGG   Homo sapiens (human): 6195Help
Entry
6195              CDS       T01001                                 

Gene name
RPS6KA1, HU-1, MAPKAPK1A, RSK, RSK1, p90Rsk
Definition
(RefSeq) ribosomal protein S6 kinase A1
  KO
K04373  
ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6195 (RPS6KA1)
   04150 mTOR signaling pathway
    6195 (RPS6KA1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6195 (RPS6KA1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6195 (RPS6KA1)
  Nervous system
   04720 Long-term potentiation
    6195 (RPS6KA1)
   04722 Neurotrophin signaling pathway
    6195 (RPS6KA1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    6195 (RPS6KA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6195 (RPS6KA1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6195 (RPS6KA1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     6195 (RPS6KA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15418(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.11
AA seq 735 aa AA seqDB search
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgcccagctcaaggagccctggccgctcatggagctagtgcctctggacccg
gagaatggacagacctcaggggaagaagctggacttcagccgtccaaggatgagggcgtc
ctcaaggagatctccatcacgcaccacgtcaaggctggctctgagaaggctgatccatcc
catttcgagctcctcaaggttctgggccagggatcctttggcaaagtcttcctggtgcgg
aaagtcacccggcctgacagtgggcacctgtatgctatgaaggtgctgaagaaggcaacg
ctgaaagtacgtgaccgcgtccggaccaagatggagagagacatcctggctgatgtaaat
cacccattcgtggtgaagctgcactatgccttccagaccgagggcaagctctatctcatt
ctggacttcctgcgtggtggggacctcttcacccggctctcaaaagaggtgatgttcacg
gaggaggatgtgaagttttacctggccgagctggctctgggcctggatcacctgcacagc
ctgggtatcatttacagagacctcaagcctgagaacatccttctggatgaggagggccac
atcaaactcactgactttggcctgagcaaagaggccattgaccacgagaagaaggcctat
tctttctgcgggacagtggagtacatggcccctgaggtcgtcaaccgccagggccactcc
catagtgcggactggtggtcctatggggtgttgatgtttgagatgctgacgggctccctg
cccttccaggggaaggaccggaaggagaccatgacactgattctgaaggcgaagctaggc
atgccccagtttctgagcactgaagcccagagcctcttgcgggccctgttcaagcggaat
cctgccaaccggctcggctccggccctgatggggcagaggaaatcaagcggcatgtcttc
tactccaccattgactggaataagctataccgtcgtgagatcaagccacccttcaagcca
gcagtggctcagcctgatgacaccttctactttgacaccgagttcacgtcccgcacaccc
aaggattccccaggcatcccccccagcgctggggcccatcagctgttccggggcttcagc
ttcgtggccaccggcctgatggaagacgacggcaagcctcgtgccccgcaggcacccctg
cactcggtggtacagcaactccatgggaagaacctggtttttagtgacggctacgtggta
aaggagacaattggtgtgggctcctactctgagtgcaagcgctgtgtccacaaggccacc
aacatggagtatgctgtcaaggtcattgataagagcaagcgggatccttcagaagagatt
gagattcttctgcggtatggccagcaccccaacatcatcactctgaaagatgtgtatgat
gatggcaaacacgtgtacctggtgacagagctgatgcggggtggggagctgctggacaag
atcctgcggcagaagttcttctcagagcgggaggccagctttgtcctgcacaccattggc
aaaactgtggagtatctgcactcacagggggttgtgcacagggacctgaagcccagcaac
atcctgtatgtggacgagtccgggaatcccgagtgcctgcgcatctgtgactttggtttt
gccaaacagctgcgggctgagaatgggctcctcatgacaccttgctacacagccaacttt
gtggcgcctgaggtgctgaagcgccagggctacgatgaaggctgcgacatctggagcctg
ggcattctgctgtacaccatgctggcaggatatactccatttgccaacggtcccagtgac
acaccagaggaaatcctaacccggatcggcagtgggaagtttaccctcagtgggggaaat
tggaacacagtttcagagacagccaaggacctggtgtccaagatgctacacgtggatccc
caccagcgcctcacagctaagcaggttctgcagcatccatgggtcacccagaaagacaag
cttccccaaagccagctgtcccaccaggacctacagcttgtgaagggagccatggctgcc
acgtactccgcactcaacagctccaagcccaccccccagctgaagcccatcgagtcatcc
atcctggcccagcggcgagtgaggaagttgccatccaccaccctgtga

KEGG   Homo sapiens (human): 6196Help
Entry
6196              CDS       T01001                                 

Gene name
RPS6KA2, HU-2, MAPKAPK1C, RSK, RSK3, S6K-alpha, S6K-alpha2, p90-RSK3, p90RSK2, pp90RSK3
Definition
(RefSeq) ribosomal protein S6 kinase A2
  KO
K04373  
ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6196 (RPS6KA2)
   04150 mTOR signaling pathway
    6196 (RPS6KA2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6196 (RPS6KA2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6196 (RPS6KA2)
  Nervous system
   04720 Long-term potentiation
    6196 (RPS6KA2)
   04722 Neurotrophin signaling pathway
    6196 (RPS6KA2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    6196 (RPS6KA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6196 (RPS6KA2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6196 (RPS6KA2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     6196 (RPS6KA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15349(Tchem)
UniProt: 
Position
6q27
AA seq 733 aa AA seqDB search
MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFE
LLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGI
IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCN
RLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDS
PGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
FVYLVMELMRGGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILY
RDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGIL
LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQR
LTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLA
QRRGMKRLTSTRL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggacctgagcatgaagaagttcgccgtgcgcaggttcttctctgtgtacctgcgcagg
aagtcgcgctccaagagctccagcctgagccggctcgaggaagaaggcgtcgtgaaggag
atagacatcagccatcatgtgaaggagggctttgagaaggcagatccttcccagtttgag
ctgctgaaggttttaggacaaggatcctatggaaaggtgttcctggtgaggaaggtgaag
gggtccgacgctgggcagctctacgccatgaaggtccttaagaaagccaccctaaaagtt
cgggaccgagtgagatcgaagatggagagagacatcttggcagaagtgaatcaccccttc
attgtgaagcttcattatgcctttcagacggaaggaaagctctacctgatcctggacttc
ctgcggggaggggacctcttcacccggctctccaaagaggtcatgttcacggaggaggat
gtcaagttctacctggctgagctggccttggctttagaccatctccacagcctggggatc
atctacagagatctgaagcctgagaacatcctcctggatgaagaggggcacattaagatc
acagatttcggcctgagtaaggaggccattgaccacgacaagagagcgtactccttctgc
gggacgatcgagtacatggcgcccgaggtggtgaaccggcgaggacacacgcagagtgcc
gactggtggtccttcggcgtgctcatgtttgagatgctcacggggtccctgccgttccag
gggaaggacaggaaggagaccatggctctcatcctcaaagccaagctggggatgccgcag
ttcctcagtggggaggcacagagtttgctgcgagctctcttcaaacggaacccctgcaac
cggctgggtgctggcattgacggagtggaggaaattaagcgccatcccttctttgtgacc
atagactggaacacgctgtaccggaaggagatcaagccaccgttcaaaccagcagtgggc
aggcctgaggacaccttccactttgaccccgagttcacagcgcggacgcccacagactct
cctggcgtccccccgagtgcaaacgctcatcacctgtttagaggattcagctttgtggcc
tcaagcctgatccaggagccctcacagcaagatctgcacaaagtcccagttcacccaatc
gtgcagcagttacacgggaacaacatccacttcaccgatggctacgagatcaaggaggac
atcggggtgggctcctactcagtgtgcaagcgatgtgtgcataaagccacagacaccgag
tatgccgtgaagatcattgataagagcaagagagacccctcggaagagattgagatcctc
ctgcggtacggccagcacccgaacatcatcaccctcaaggatgtctatgatgatggcaag
tttgtgtacctggtaatggagctgatgcgtggtggggagctcctggaccgcatcctccgg
cagagatacttctcggagcgcgaagccagtgacgtcctgtgcaccatcaccaagaccatg
gactacctccattcccagggggttgttcatcgagacctgaagccgagtaacatcctgtac
agggatgagtcggggagcccagaatccatccgagtctgcgacttcggctttgccaagcag
ctgcgcgcggggaacgggctgctcatgacaccctgctacacggccaatttcgtggccccg
gaggtcctgaagcgtcaaggctatgatgcggcgtgtgacatctggagtttggggatcctg
ttgtacaccatgctggcaggatttaccccttttgcaaatgggccagacgatacccctgag
gagattctggcgcggatcggcagtgggaagtatgccctttctgggggaaactgggactcg
atatctgacgcagctaaagacgtcgtgtccaagatgctccacgtggaccctcatcagcgc
ctgacggcgatgcaagtgctcaaacacccgtgggtggtcaacagagagtacctgtcccca
aaccagctcagccgacaggacgtgcacctggtgaagggcgcgatggccgccacctacttt
gctctaaacagaacacctcaggccccgcggctggagcccgtgctgtcatccaacctggct
cagcgcagaggcatgaagagactcacgtccacgcggctgtag

KEGG   Homo sapiens (human): 6197Help
Entry
6197              CDS       T01001                                 

Gene name
RPS6KA3, CLS, HU-3, ISPK-1, MAPKAPK1B, MRX19, RSK, RSK2, S6K-alpha3, p90-RSK2, pp90RSK2
Definition
(RefSeq) ribosomal protein S6 kinase A3
  KO
K04373  
ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Disease
H00480  
Non-syndromic X-linked mental retardation
H00574  
Coffin-Lowry syndrome (CLS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6197 (RPS6KA3)
   04150 mTOR signaling pathway
    6197 (RPS6KA3)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6197 (RPS6KA3)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6197 (RPS6KA3)
  Nervous system
   04720 Long-term potentiation
    6197 (RPS6KA3)
   04722 Neurotrophin signaling pathway
    6197 (RPS6KA3)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    6197 (RPS6KA3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6197 (RPS6KA3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6197 (RPS6KA3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     6197 (RPS6KA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P51812(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.12
AA seq 740 aa AA seqDB search
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcgcagctggcggacccgtggcagaagatggctgtggagagcccgtccgac
agcgctgagaatggacagcaaattatggatgaacctatgggagaggaggagattaaccca
caaactgaagaagtcagtatcaaagaaattgcaatcacacatcatgtaaaggaaggacat
gaaaaggcagatccttcccagtttgaacttttaaaagtattagggcagggatcatttgga
aaggttttcttagttaaaaaaatctcaggctctgatgctaggcagctttatgccatgaag
gtattgaagaaggccacactgaaagttcgagaccgagttcggacaaaaatggaacgtgat
atcttggtagaggttaatcatccttttattgtcaagttgcattatgcttttcaaactgaa
gggaagttgtatcttattttggattttctcaggggaggagatttgtttacacgcttatcc
aaagaggtgatgttcacagaagaagatgtcaaattctacttggctgaacttgcacttgct
ttagaccatctacatagcctgggaataatttatagagacttaaaaccagaaaatatactt
cttgatgaagaaggtcacatcaagttaacagatttcggcctaagtaaagagtctattgac
catgaaaagaaggcatattctttttgtggaactgtggagtatatggctccagaagtagtt
aatcgtcgaggtcatactcagagtgctgactggtggtcttttggtgtgttaatgtttgaa
atgcttactggtacactccctttccaaggaaaagatcgaaaagaaacaatgactatgatt
cttaaagccaaacttggaatgccacagtttttgagtcctgaagcgcagagtcttttacga
atgcttttcaagcgaaatcctgcaaacagattaggtgcaggaccagatggagttgaagaa
attaaaagacattcatttttctcaacgatagactggaataaactgtatagaagagaaatt
catccgccatttaaacctgcaacgggcaggcctgaagatacattctattttgatcctgag
tttactgcaaaaactcccaaagattcacctggcattccacctagtgctaatgcacatcag
ctttttcgggggtttagttttgttgctattacctcagatgatgaaagccaagctatgcag
acagttggtgtacattcaattgttcagcagttacacaggaacagtattcagtttactgat
ggatatgaagtaaaagaagatattggagttggctcctactctgtttgcaagagatgtata
cataaagctacaaacatggagtttgcagtgaagattattgataaaagcaagagagaccca
acagaagaaattgaaattcttcttcgttatggacagcatccaaacattatcactctaaag
gatgtatatgatgatggaaagtatgtgtatgtagtaacagaacttatgaaaggaggtgaa
ttgctggataaaattcttagacaaaaatttttctctgaacgagaggccagtgctgtcctg
ttcactataactaaaaccgttgaatatcttcacgcacaaggggtggttcatagagacttg
aaacctagcaacattctttatgtggatgaatctggtaatccggaatctattcgaatttgt
gattttggctttgcaaaacagctgagagcggaaaatggtcttctcatgactccttgttac
actgcaaattttgttgcaccagaggttttaaaaagacaaggctatgatgctgcttgtgat
atatggagtcttggtgtcctactctatacaatgcttaccggttacactccatttgcaaat
ggtcctgatgatacaccagaggaaatattggcacgaataggtagcggaaaattctcactc
agtggtggttactggaattctgtttcagacacagcaaaggacctggtgtcaaagatgctt
catgtagaccctcatcagagactgactgctgctcttgtgctcagacatccttggatcgtc
cactgggaccaactgccacaataccaactaaacagacaggatgcaccacatctagtaaag
ggtgccatggcagctacatattctgctttgaaccgtaatcagtcaccagttttggaacca
gtaggccgctctactcttgctcagcggagaggtattaaaaaaatcacctcaacagccctg
tga

DBGET integrated database retrieval system