KEGG   Homo sapiens (human): 27334Help
Entry
27334             CDS       T01001                                 

Gene name
P2RY10, LYPSR2, P2Y10
Definition
(RefSeq) purinergic receptor P2Y10
  KO
K04274  
purinergic receptor P2Y, G protein-coupled, 10
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    27334 (P2RY10)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    27334 (P2RY10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq21.1
AA seq 339 aa AA seqDB search
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLC
RFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYAS
ICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKS
CFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQK
ALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLL
DPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctaaccttgacaaatacactgaaacattcaagatgggtagcaacagtaccagcact
gctgagatttactgtaatgtcactaatgtgaaatttcaatactccctctatgcaaccacc
tatatcctcatattcattcctggtcttctggctaacagtgcagccttgtgggttctgtgc
cgcttcatcagcaagaaaaataaagccatcattttcatgatcaacctctctgtggctgac
cttgctcatgtattatctttacccctccggatttactattacatcagccaccactggcct
ttccagagagccctttgcctgctctgcttctacctgaagtatctcaacatgtatgccagc
atttgtttcctgacgtgcatcagtcttcaaaggtgcttttttctcctcaagcccttcagg
gccagagactggaagcgtaggtacgatgtgggcatcagtgctgccatctggatcgttgtg
gggactgcctgtttgccatttcccatcctgagaagcacagacttaaacaacaacaagtcc
tgctttgctgatcttggatacaagcaaatgaatgcagttgcgttggtcgggatgattaca
gttgctgagcttgcaggatttgtgatcccagtgatcatcatcgcatggtgtacctggaaa
actactatatccttgagacagccaccaatggctttccaagggatcagtgagaggcagaaa
gcactgcggatggtgttcatgtgtgctgcagtcttcttcatctgcttcactccctatcat
attaactttattttttacaccatggtaaaggaaaccatcattagcagttgtcccgttgtc
cgaatcgcactgtatttccaccctttttgcctgtgccttgcaagtctctgctgccttttg
gatccaattctttattactttatggcttcagagtttcgtgaccaactatcccgccatggc
agttctgtgacccgctcccgcctcatgagcaaggagagtggttcatcaatgattggctaa

DBGET integrated database retrieval system