KEGG   Homo sapiens (human): 27338Help
Entry
27338             CDS       T01001                                 

Gene name
UBE2S, E2-EPF, E2EPF, EPF5
Definition
(RefSeq) ubiquitin-conjugating enzyme E2S (EC:6.3.2.19)
  KO
K10583  
ubiquitin-conjugating enzyme E2 S [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    27338 (UBE2S)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     27338 (UBE2S)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   27338 (UBE2S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.43
AA seq 222 aa AA seqDB search
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF
RMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLL
IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASST
DPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaacgtggagaacctacccccgcacatcatccgcctggtgtacaaggaggtg
acgacactgaccgcagacccacccgatggcatcaaggtctttcccaacgaggaggacctc
accgacctccaggtcaccatcgagggccctgaggggaccccatatgctggaggtctgttc
cgcatgaaactcctgctggggaaggacttccctgcctccccacccaagggctacttcctg
accaagatcttccacccgaacgtgggcgccaatggcgagatctgcgtcaacgtgctcaag
agggactggacggctgagctgggcatccgacacgtactgctgaccatcaagtgcctgctg
atccaccctaaccccgagtctgcactcaacgaggaggcgggccgcctgctcttggagaac
tacgaggagtatgcggctcgggcccgtctgctcacagagatccacgggggcgccggcggg
cccagcggcagggccgaagccggtcgggccctggccagtggcactgaagcttcctccacc
gaccctggggccccagggggcccgggaggggctgagggtcccatggccaagaagcatgct
ggcgagcgcgataagaagctggcggccaagaaaaagacggacaagaagcgggcgctgcgg
cggctgtag

DBGET integrated database retrieval system