KEGG   Homo sapiens (human): 27338Help
Entry
27338             CDS       T01001                                 

Gene name
UBE2S, E2-EPF, E2EPF, EPF5
Definition
ubiquitin-conjugating enzyme E2S (EC:6.3.2.19)
Orthology
K10583  
ubiquitin-conjugating enzyme E2 S [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.43
AA seq 222 aa AA seqDB search
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF
RMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLL
IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASST
DPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaacgtggagaacctacccccgcacatcatccgcctggtgtacaaggaggtg
acgacactgaccgcagacccacccgatggcatcaaggtctttcccaacgaggaggacctc
accgacctccaggtcaccatcgagggccctgaggggaccccatatgctggaggtctgttc
cgcatgaaactcctgctggggaaggacttccctgcctccccacccaagggctacttcctg
accaagatcttccacccgaacgtgggcgccaatggcgagatctgcgtcaacgtgctcaag
agggactggacggctgagctgggcatccgacacgtactgctgaccatcaagtgcctgctg
atccaccctaaccccgagtctgcactcaacgaggaggcgggccgcctgctcttggagaac
tacgaggagtatgcggctcgggcccgtctgctcacagagatccacgggggcgccggcggg
cccagcggcagggccgaagccggtcgggccctggccagtggcactgaagcttcctccacc
gaccctggggccccagggggcccgggaggggctgagggtcccatggccaagaagcatgct
ggcgagcgcgataagaagctggcggccaagaaaaagacggacaagaagcgggcgctgcgg
cggctgtag

DBGET integrated database retrieval system