KEGG   Homo sapiens (human): 27338Help
Entry
27338             CDS       T01001                                 

Gene name
UBE2S, E2-EPF, E2EPF, EPF5
Definition
ubiquitin-conjugating enzyme E2S (EC:6.3.2.19)
Orthology
K10583  
ubiquitin-conjugating enzyme E2 S [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    27338 (UBE2S)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     27338 (UBE2S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.43
AA seq 222 aa AA seqDB search
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF
RMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLL
IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASST
DPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaacgtggagaacctacccccgcacatcatccgcctggtgtacaaggaggtg
acgacactgaccgcagacccacccgatggcatcaaggtctttcccaacgaggaggacctc
accgacctccaggtcaccatcgagggccctgaggggaccccatatgctggaggtctgttc
cgcatgaaactcctgctggggaaggacttccctgcctccccacccaagggctacttcctg
accaagatcttccacccgaacgtgggcgccaatggcgagatctgcgtcaacgtgctcaag
agggactggacggctgagctgggcatccgacacgtactgctgaccatcaagtgcctgctg
atccaccctaaccccgagtctgcactcaacgaggaggcgggccgcctgctcttggagaac
tacgaggagtatgcggctcgggcccgtctgctcacagagatccacgggggcgccggcggg
cccagcggcagggccgaagccggtcgggccctggccagtggcactgaagcttcctccacc
gaccctggggccccagggggcccgggaggggctgagggtcccatggccaagaagcatgct
ggcgagcgcgataagaagctggcggccaagaaaaagacggacaagaagcgggcgctgcgg
cggctgtag

DBGET integrated database retrieval system