KEGG   Homo sapiens (human): 27339Help
Entry
27339             CDS       T01001                                 

Gene name
PRPF19, NMP200, PRP19, PSO4, SNEV, UBOX4, hPSO4
Definition
(RefSeq) pre-mRNA processing factor 19
  KO
K10599  
pre-mRNA-processing factor 19 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Ubiquitin mediated proteolysis
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    27339 (PRPF19)
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    27339 (PRPF19)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     27339 (PRPF19)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    27339 (PRPF19)
 Complex C
   Prp19-CDC5 complex
    27339 (PRPF19)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   27339 (PRPF19)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   PSO4 complex
    27339 (PRPF19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.2
AA seq 504 aa AA seqDB search
MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
IRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARL
TKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKA
TVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQ
VVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHP
DGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaatctgctccatctctaacgaagtgccggagcacccatgtgtatcccctgtc
tctaatcatgtttatgagcggcggctcatcgagaagtacattgcggagaatggtaccgac
cccatcaacaaccagcctctctccgaggagcagctcatcgacatcaaagttgctcaccca
atccggcccaagcctccctcagccaccagcatcccggccattctgaaagctttgcaggat
gagtgggatgcagtcatgctgcacagcttcactctgcgccagcagctgcagacaacccgc
caagagctgtcacacgctctgtaccagcacgatgccgcctgccgtgtcattgcccgtctc
accaaggaagtcactgctgcccgagaagctctggctaccctgaaaccacaggctggcctc
attgtgccccaggctgtgccaagttcccaaccaagtgttgtgggtgcgggtgagccaatg
gatttgggtgagctggtgggaatgaccccagagattattcagaagcttcaagacaaagcc
actgtgctaaccacggagcgcaagaagagagggaagactgtgcctgaggagctggtgaag
ccagaagagctcagcaaataccggcaggtggcatcccacgtggggttgcacagtgccagc
attcctgggatcctggccctggacctctgcccgtccgacaccaacaagatcctcactggt
ggggcggataaaaatgtcgttgtgtttgacaaaagttctgaacaaatcctggctaccctc
aaaggccataccaagaaggtcaccagcgtggtgtttcacccttcccaggacctggtgttt
tctgcttcccccgatgccactatcaggatttggtcggtccccaatgcctcttgtgtacag
gtggttcgggcccatgagagtgctgtgacaggcctcagccttcatgccactggcgactat
ctcctgagctcctccgatgatcagtactgggctttctctgacatccagacagggcgtgtg
ctcaccaaggtgacagatgagacctccggctgctctctcacctgtgcacagttccaccct
gacggactcatctttggaacaggaaccatggactctcagatcaagatctgggacttgaag
gaacgtactaatgtggccaacttccctggccactcgggccccatcactagcatcgccttc
tctgagaatggttactacctggctacagcggctgatgactcctctgtcaagctctgggat
ctgcgcaagcttaagaactttaagactttgcagctggataacaactttgaggtaaagtca
ctgatctttgaccagagtggtacctacctggctcttgggggcacggatgtccagatctac
atctgcaaacaatggacggagattcttcactttacagagcatagcggcctgaccacaggg
gtggccttcgggcatcacgccaagttcatcgcttcaacaggcatggacagaagcctcaag
ttctacagcctgtag

DBGET integrated database retrieval system