KEGG   Homo sapiens (human): 2734Help
Entry
2734              CDS       T01001                                 

Gene name
GLG1, CFR-1, ESL-1, MG-160, MG160
Definition
(RefSeq) golgi glycoprotein 1
  KO
K06816  
golgi apparatus protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    2734 (GLG1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 3. Selectin Family
  SELE; selectin, endothelial cell [KO:K06494]
   2734 (GLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92896(Tbio)
UniProt: 
Position
16q23.1
AA seq 1179 aa AA seqDB search
MAACGRVRRMFRLSAALHLLLLFAAGAEKLPGQGVHSQGQGPGANFVSFVGQAGGGGPAG
QQLPQLPQSSQLQQQQQQQQQQQQPQPPQPPFPAGGPPARRGGAGAGGGWKLAEEESCRE
DVTRVCPKHTWSNNLAVLECLQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVC
KSTITEIKECADEPVGKGYMVSCLVDHRGNITEYQCHQYITKMTAIIFSDYRLICGFMDD
CKNDINILKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEEREPKIQVSELCKKAILRVAE
LSSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEKCREALTTRQK
LIAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQ
GEMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNC
QQALQTLIQETDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVE
DCEHRLLELQYFISRDWKLDPVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHA
YRTEEQGRRLSRECRAEVQRILHQRAMDVKLDPALQDKCLIDLGKWCSEKTETGQELECL
QDHLDDLVVECRDIVGNLTELESEDIQIEALLMRACEPIIQNFCHDVADNQIDSGDLMEC
LIQNKHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNIKKKVDVVICL
STTVRNDTLQEAKEHRVSLKCRRQLRVEELEMTEDIRLEPDLYEACKSDIKNFCSAVQYG
NAQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTM
LQCLKQNKNSELMDPKCKQMITKRQITQNTDYRLNPMLRKACKADIPKFCHGILTKAKDD
SELEGQVISCLKLRYADQRLSSDCEDQIRIIIQESALDYRLDPQLQLHCSDEISSLCAEE
AAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCA
AITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMT
SPSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDR
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgtggacgtgtacggaggatgttccgcttgtcggcggcgctgcatctgctg
ctgctattcgcggccggggccgagaaactccccggccagggcgtccacagccagggccag
ggtcccggggccaactttgtgtccttcgtagggcaggccggaggcggcggcccggcgggt
cagcagctgccccagctgcctcagtcatcgcagcttcagcagcaacagcagcagcagcaa
cagcaacagcagcctcagccgccgcagccgcctttcccggcgggtgggcctccggcccgg
cggggaggagcgggggctggtgggggctggaagctggcggaggaagagtcctgcagggag
gacgtgacccgcgtgtgccctaagcacacctggagcaacaacctggcggtgctcgagtgc
ctgcaggatgtgagggagcctgaaaatgaaatttcttcagactgcaatcatttgttgtgg
aattataagctgaacctaactacagatcccaaatttgaatctgtggccagagaggtttgc
aaatctactataacagagattaaagaatgtgctgatgaaccggttggaaaaggttacatg
gtttcctgcttggtggatcaccgaggcaacatcactgagtatcagtgtcaccagtacatt
accaagatgacggccatcatttttagtgattaccgtttaatctgtggcttcatggatgac
tgcaaaaatgacatcaacattctgaaatgtggcagtattcggcttggagaaaaggatgca
cattcacaaggtgaggtggtatcatgcttggagaaaggcctggtgaaagaagcagaagaa
agagaacccaagattcaagtttctgaactctgcaagaaagccattctccgggtggctgag
ctgtcatcggatgactttcacttagaccggcatttatattttgcttgccgagatgatcgg
gagcgtttttgtgaaaatacacaagctggtgagggcagagtgtataagtgcctctttaac
cataaatttgaagaatccatgagtgaaaagtgtcgagaagcacttacaacccgccaaaag
ctgattgcccaggattataaagtcagttattcattggccaaatcctgtaaaagtgacttg
aagaaataccggtgcaatgtggaaaaccttccgcgatcgcgtgaagccaggctctcctac
ttgttaatgtgcctggagtcagctgtacacagagggcgacaagtcagcagtgagtgccag
ggggagatgctggattaccgacgcatgttgatggaagacttttctctgagccctgagatc
atcctaagctgtcggggggagattgaacaccattgttccggattacatcgaaaagggcgg
accctacactgtctgatgaaagtagttcgaggggagaaggggaaccttggaatgaactgc
cagcaggcgcttcaaacactgattcaggagactgaccctggtgcagattaccgcattgat
cgagctttgaatgaagcttgtgaatctgtaatccagacagcctgcaaacatataagatct
ggagacccaatgatcttgtcgtgcctgatggaacatttatacacagagaagatggtagaa
gactgtgaacaccgtctcttagagctgcagtatttcatctcccgggattggaagctggac
cctgtcctgtaccgcaagtgccagggagacgcttctcgtctttgccacacccacggttgg
aatgagaccagtgaatttatgcctcagggagctgtgttctcttgtttatacagacacgcc
taccgcactgaggaacagggaaggaggctctcacgggagtgccgagctgaagtccaaagg
atcctacaccagcgtgccatggatgtcaagctggatcctgccctccaggataagtgcctg
attgatctgggaaaatggtgcagtgagaaaacagagactggacaggagctggagtgcctt
caggaccatctggatgacttggtggtggagtgtagagatatagttggcaacctcactgag
ttagaatcagaggatattcaaatagaagccttgctgatgagagcctgtgagcccataatt
cagaacttctgccacgatgtggcagataaccagatagactctggggacctgatggagtgt
ctgatacagaacaaacaccagaaggacatgaacgagaagtgtgccatcggagttacccac
ttccagctggtgcagatgaaggattttcggttttcttacaagtttaaaatggcctgcaag
gaggacgtgttgaagctttgcccaaacataaaaaagaaggtggacgtggtgatctgcctg
agcacgaccgtgcgcaatgacactctgcaggaagccaaggagcacagggtgtccctgaag
tgccgcaggcagctccgtgtggaggagctggagatgacggaggacatccgcttggagcca
gatctatacgaagcctgcaagagtgacatcaaaaacttctgttccgctgtgcaatatggc
aacgctcagattatcgaatgtctgaaagaaaacaagaagcagctaagcacccgctgccac
caaaaagtatttaagctgcaggagacagagatgatggacccagagctagactacaccctc
atgagggtctgcaagcagatgataaagaggttctgtccggaagcagattctaaaaccatg
ttgcagtgcttgaagcaaaataaaaacagtgaattgatggatcccaaatgcaaacagatg
ataaccaagcgccagatcacccagaacacagattaccgcttaaaccccatgttaagaaaa
gcctgtaaagctgacattcctaaattctgtcacggtatcctgactaaggccaaggatgat
tcagaattagaaggacaagtcatctcttgcctgaagctgagatatgctgaccagcgcctg
tcttcagactgtgaagaccagatccgaatcattatccaggagtccgccctggactaccgc
ctggatcctcagctccagctgcactgctcagacgagatctccagtctatgtgctgaagaa
gcagcagcccaagagcagacaggtcaggtggaggagtgcctcaaggtcaacctgctcaag
atcaaaacagaattgtgtaaaaaggaagtgctaaacatgctgaaggaaagcaaagcagac
atctttgttgacccggtacttcatactgcttgtgccctggacattaaacaccactgcgca
gccatcacccctggccgcgggcgtcaaatgtcctgtctcatggaagcactggaggataag
cgggtgaggttacagcccgagtgcaaaaagcgcctcaatgaccggattgagatgtggagt
tacgcagcaaaggtggccccagcagatggcttctctgatcttgccatgcaagtaatgacg
tctccatctaagaactacattctctctgtgatcagtgggagcatctgtatattgttcctg
attggcctgatgtgtggacggatcaccaagcgagtgacacgagagctcaaggacaggtag

DBGET integrated database retrieval system